SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171059689|ref|YP_001792038.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059689|ref|YP_001792038.1|
Domain Number 1 Region: 27-353
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 9.57e-67
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00089
Further Details:      
 
Domain Number 2 Region: 358-556
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 5.36e-49
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171059689|ref|YP_001792038.1|
Sequence length 557
Comment 5'-nucleotidase domain-containing protein [Leptothrix cholodnii SP-6]
Sequence
MRITRLICPPLIAALAALSGCGLFGPREAPPVAVKVLAINDFHGNLKPPLGGVRIRDPQD
AGKTVSVPAGGAEHLASALREARAKNPNHIFVAAGDLVGASPLLSALFHDEPTIEALGLM
GLEASAVGNHEFDRGAAELLRQQNGGCHPKDGCRGPQDFRGARFQYLAASTIDTRTGRTL
LPAYHVKRFEGIPVAFVGLTLAGTPRIVTPAGVAGLAFRDEAQTVNALVPQLRAQGIEAI
VVLIHEGGFPSGDHNECPGISGPIVGIVERLDPAVDLVVSGHTHRAYNCRIGGRLVTSAD
KYGTVLTEIDLQLDPRSGDVLQARADNLIVRTDRYARDAEQSRLIARYETLAAPLAGRVV
GYMSGRLTREENAAGESVIGQVVADAQLMATEHPLSGGAQIALMNPGGLRADLAAGDGGV
VRYEDIFAVQPFYNNLVTLSLTGAQLRQLLEQQWLDQPRPRILQVSRGFSYSWDASRPPG
QRVRADSLRLNGQPIGADTRYRVSVNSFLASGGDGFSVFRQGLEPVTGMMDVDAFEAYFR
SHERLDVRHDERIRRLP
Download sequence
Identical sequences B1XZA3
395495.Lcho_3013 gi|171059689|ref|YP_001792038.1| WP_012348024.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]