SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170736141|ref|YP_001777401.1| from Burkholderia cenocepacia MC0-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170736141|ref|YP_001777401.1|
Domain Number 1 Region: 2-364
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1e-107
Family FMN-linked oxidoreductases 0.0000000021
Further Details:      
 
Domain Number 2 Region: 335-522
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.59e-40
Family N-terminal domain of adrenodoxin reductase-like 0.0000145
Further Details:      
 
Domain Number 3 Region: 464-522,558-655
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.49e-28
Family C-terminal domain of adrenodoxin reductase-like 0.0000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170736141|ref|YP_001777401.1|
Sequence length 677
Comment NADH:flavin oxidoreductase/NADH oxidase [Burkholderia cenocepacia MC0-3]
Sequence
MTTPFPHLLAPLDLGFTTLKNRVLMGSMHTGLEDSRKTLPRLAEYFAERARGGVGLIVTG
GFAPNVAGWTKPFGGTLMTSAAARRHREITGAVHAEDGKIALQILHTGRYGYHPFAVAPS
KIKSPISPFAPHELSARGVERQIRAFVRCATLAREAGYDGVEIMGSEGYLINQFISMHTN
KRTDQWGGSYENRIRLPIEIVERTREAVGRDFILIYRLSMLDLIPDGSDWSETVQLAKAV
ERAGATIINTGIGWHEARVPTIATSVPRGAFAWVTKKMKGEVGIPLVTTNRINRPEVAEQ
ILADGCADMVSMARPLLADAEFVVKAAQGRADEINTCIGCNQACLDHAFKNKIASCLLNP
RACHETELKYTPAPQPKRIAVVGAGPAGLACSTVLAQRGHQVDLFDGAAEIGGQFNMAKR
IPGKEEFHEALSYFGRQVELTGVKLHLNRRVDASHLIAGGYDEIVLATGVAPRDPKIPGQ
DGPNVLSYIDVLAGKQRVGRRVAVVGAGGIGFDVAEYLVQDGESPALDLDEWKAEWGVTD
PATTRGGVTRAQVSAPAREVTLLQRKAAPLGKGLGKTTGWIHRATLKMKQVKMIGGVNYE
RIDAGGLHVSYGEQRTDHELIEADTIVLCTGQEPQRALLAPLQAAGRSVHLIGGAELAAE
LDAKRAIDQGARLAARL
Download sequence
Identical sequences B1K4Y7
406425.Bcenmc03_3759 WP_012338522.1.90614 gi|170736141|ref|YP_001777401.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]