SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170736320|ref|YP_001777580.1| from Burkholderia cenocepacia MC0-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170736320|ref|YP_001777580.1|
Domain Number 1 Region: 39-389
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.36e-26
Family C-terminal domain of adrenodoxin reductase-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170736320|ref|YP_001777580.1|
Sequence length 486
Comment monooxygenase FAD-binding [Burkholderia cenocepacia MC0-3]
Sequence
MTAPLDALEARLAQDLRWLDLPAPSWVPPREADGTRVLDVAIVGGGMAGLAASAELRLLG
IDNQCVIDRAPAGYEGPWVTFARMETLRSPKQLAGPALGLPALTFRAWFEAQYGRDAWDA
LYKIPRPQWMEYLRWYRRVLDLQVRNDTTLVALRPRDDGLLALDVHGNGEAQTLLARHVV
LATGRDGLGGPYVPPVAQRAPRTRWAHSSEPIDFGALAGKHVGVVGAGASAFDNAGTALE
AGAARVDLFFRRADIPRINKLTGIGSPGLVHGYADLDDATKWRFMHYALTSQTPPPRDSV
LRVSRHDHAHFHAGSPIETLADHADGLDVTTPRGRYTVDFLIFATGFHSDWTTRDKFASF
GAHVRRWKDRYRPEPALWLDELAESPDLGPAFAFQERERGACPAVTRIHCFNHAASLSHG
KLSGDIPAISAGAQRLARGIASRLFDADRDRHYDALVAYANAELQGDEWRDADALDHFDD
EGIPNR
Download sequence
Identical sequences B1K627
WP_012338679.1.90614 406425.Bcenmc03_3939 gi|170736320|ref|YP_001777580.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]