SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MAPG_05651T0 from Magnaporthe poae ATCC 64411 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MAPG_05651T0
Domain Number 1 Region: 86-128
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.00000000314
Family Ribosomal protein L36 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MAPG_05651T0
Sequence length 129
Comment pep:novel supercontig:Mag_poae_ATCC_64411_V1:supercont1.4:2706836:2707867:1 gene:MAPG_05651 transcript:MAPG_05651T0 description:"hypothetical protein"
Sequence
MASISILSRAARASSLVASMRGLSINPQQQQHAFQQTRLLSRSIFGSMAPRARTCGGALP
LVASVSTRPVVAAGRAAAVQQQTRGMKLRSAITKRCEHCKVVRRKRGKRHRGWRYVICSA
NPRHKQRQS
Download sequence
Identical sequences A0A0C4DZY8
MAPG_05651T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]