SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MAPG_06631T0 from Magnaporthe poae ATCC 64411 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MAPG_06631T0
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Pre-PUA domain 6.54e-36
Family Nip7p homolog, N-terminal domain 0.0000734
Further Details:      
 
Domain Number 2 Region: 97-172
Classification Level Classification E-value
Superfamily PUA domain-like 2.49e-23
Family PUA domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MAPG_06631T0
Sequence length 185
Comment pep:novel supercontig:Mag_poae_ATCC_64411_V1:supercont1.5:2427103:2428351:-1 gene:MAPG_06631 transcript:MAPG_06631T0 description:"60S ribosome subunit biogenesis protein NIP7"
Sequence
MRPLTDTETQTLLAKLANYTGNSLKTLIAPLEDGDRYVFRLHKDRVYYVRLSIANLATSI
AREKLMSLGTCLGKFTKSGKFRLHITALSILSEHARYKIWVRSNGEMPFLYGGNIVKAHV
GRQTDDCPEHQGIVVYNMQDVPLGFGLTAKSTADARRLDPTGITCFRQADCGEYLRDEDT
LFATG
Download sequence
Identical sequences A0A0C4E2J3
MAPG_06631T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]