SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MAPG_02723T0 from Magnaporthe poae ATCC 64411 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MAPG_02723T0
Domain Number 1 Region: 136-641
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.94e-158
Family Calponin-homology domain, CH-domain 0.00000000000143
Further Details:      
 
Domain Number 2 Region: 6-90,160-180
Classification Level Classification E-value
Superfamily EF-hand 0.000000141
Family Calmodulin-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MAPG_02723T0
Sequence length 648
Comment pep:novel supercontig:Mag_poae_ATCC_64411_V1:supercont1.2:2727692:2730416:-1 gene:MAPG_02723 transcript:MAPG_02723T0 description:"fimbrin"
Sequence
MNVLKLQRKFPQFQQNEIFELSNSFAKLDVDDKGYLDEATAIKATQQSERQPYDVVRQAL
KEVELDSSRRVELEDYVGLIAKLRDSSPAQKRMSTGPGPLSPSGVVAQRTGGHASKSSVS
GKIQVQGSNANITHTINEDERTEFTRHINAVLAGDPDIGNRLPFPTDTFEMFDECKDGLV
LAKLINDSVPDTIDERVLNRPGKKTKNLNAFQMTENNNIVIESAKGIGCSVVNIGSGDII
EVREHLILGLIWQVIRRGLLGKIDIKLHPELYRLLEDDETLEQFLRLPPEQILLRWFNYH
LKAANWPRRVNNFSSDVKDGENYTVLLAQIGSEYGVTRAPLQTNDLLQRAEQVLQNADVL
GCRKFLTPTSLVAGNPKLNLAFVANLFNTHPALDPITEEEKLEVEDFDAEGEREARVFTL
WLNSLDVQPAVVSFFDDLQNGTILMQAYDKVIPGSVNWRHVNKPPAHGGEMSRFKAVENT
NYAIELGKQNGFSLVGIQGADITDGQKTLTLGLVWQLMRRDITMTLSALAQRLGKREITD
AEMVRWANDMSRKGGQSSSIRSFKDSAIGTGVFLLDVLNGMKSSYVDYELVTAGRTDEEA
YLNAKLSISIARKMGATIWLVPEDICQVRSRLVTTFIGSLMATHEKMQ
Download sequence
Identical sequences A0A0C4DS49
MAPG_02723T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]