SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MAPG_10380T0 from Magnaporthe poae ATCC 64411 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MAPG_10380T0
Domain Number 1 Region: 336-537
Classification Level Classification E-value
Superfamily MIR domain 5.1e-58
Family MIR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MAPG_10380T0
Sequence length 972
Comment pep:novel supercontig:Mag_poae_ATCC_64411_V1:supercont1.10:465384:470099:-1 gene:MAPG_10380 transcript:MAPG_10380T0 description:"dolichyl-phosphate-mannose-protein mannosyltransferase 1"
Sequence
MARAAEAAKPPAQAAAAKPHAASNNKVGKAKSNRPNDYTSEGVEDNDVFLLPVSDYQVMM
VITMLAAAVRLFRIYQPTSVVFDEVHFGGFASKYIKGRFFMDVHPPLAKLLITLAGWLAG
FDGNFDFKEIGKDYLEPKVPYVAMRMFPAVCGILLAPTMFLTLKALGCRTIIAMVGACLI
IFENGLLTQARLILLDSPLMITTAFSALAFSSFTNQHEQGPSKAFGPSWWFWLAMTGLGL
GANFSIKWVGLFTIAWVGALTLVQLWVLWGDYKNVTVRVFAKHFLARVLCLIVIPAAVYM
GMFAIHFVCLVNPGDGDGFMSSEFQSTLNSKGMQDVPVDVLMGSRVAIRHLNTQGGYLHS
HPLMYPTGSKQQQITLYPHKDDNNYWFLENQTQPLDANGVQINGTSAWNNIDPLPYIKDG
DVLRLYHVPTHRRLHSHDVRPPVTEADWQNEVSAYGYEGFDGDANDYFRVEIVKKKSASG
VARERLRTIETKFRLIHVMTGCVLFSHKVKLPDWASEQQEVTCARGGTLPNSIWYIEANE
HARLDDTAEKVNYRKPGFFSKFIELNTVMWKTNAGLVESHAWDSRPDAWPLLKRGINFWG
KDHRQIYLMGNPVVWYTSTLAVVIYVLFKGIAVLRWQRSCNDYSNVTFKRFDYEIGSSVL
GWALHYFPFYLMSRQLFLHHYFPALYFAIIAWCQVMDFTLTRFKGIGLRENPIVGKAIAV
GFLSVSIVAFLLFSPLAYGNAWTKSECNRLKLFSGWDWDCNNFLDSYAAYSSLTAPAPAA
VPTPQKPVDAKVAPPVIPAQGAQEQAAKPPAPPPGISGAPDPAFAQDGSPKQRILSREER
VEYRDQDGNLLNEEQVKALEGKVEFKTRYETRTRVVDEHGREIVNPDQAAAAAAAQAAAK
KEPEGAAAGQGKPAAGVAPPHPDVEGAAESTKINVDTLVKDDPIQPSEEGSKEMEQRLPK
PASGGGEATKGV
Download sequence
Identical sequences A0A0C4ECF6
MAPG_10380T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]