SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182434570|ref|YP_001822289.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182434570|ref|YP_001822289.1|
Domain Number 1 Region: 11-209
Classification Level Classification E-value
Superfamily DhaL-like 4.58e-44
Family DhaL-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|182434570|ref|YP_001822289.1|
Sequence length 221
Comment dihydroxyacetone kinase subunit 2 [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MTTTTSPDAFSTDAWMRRFVQSAQAAKGGLTSLDQEVGDGDFGINLSTGAASTLRRLDAD
PASRDDPAAPLHAAATAFLDDVGGTSGPLFGLLFQALAVAVADAGAATTPALAAGAGEGL
AAIRRVGDAAPGDKTLVDALGPAAEALLTAPADTLPGESLERAADAAWAGVRETARLRAR
MGRSSYLGSRAEGVPDPGAVGIGMLFTSARAVVEDISTLLD
Download sequence
Identical sequences B1VSQ2
gi|182434570|ref|YP_001822289.1| WP_012378061.1.20467 WP_012378061.1.58927 WP_012378061.1.60218 WP_012378061.1.6712 455632.SGR_777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]