SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182434618|ref|YP_001822337.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182434618|ref|YP_001822337.1|
Domain Number 1 Region: 4-367
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.16e-111
Family FMN-linked oxidoreductases 0.00000000181
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.18e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000016
Further Details:      
 
Domain Number 3 Region: 461-519,555-649
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.89e-23
Family C-terminal domain of adrenodoxin reductase-like 0.0000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|182434618|ref|YP_001822337.1|
Sequence length 671
Comment 2,4-dienoyl-CoA reductase [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MSLYPNLLSPLDLGFTTLPNRVLMGSMHIGLEEAERGFERMAAFYAERARGGVGLMVTGG
IAPSERACSFPGGAKMTTEAEAEQHREITSAVHAAGGRIAMQILHFGRYAHHPDLVAPSA
IQAPISGFVPNALTGEQVEETIEEFVRAAELARFAGYDGVEIMGSEGYLINEFIVSATNH
RTDRWGGSYENRIRLPLEIVRRVRERVGDDFILIYRLSMLDLVPGGSTLEEVVTLAKEIE
AAGATIINTGIGWHEARIPTIATSVPRGAFSWVTERVRGAVSVPLVTSNRINTPEVAEEI
LASGRADLVSMARPFLADPEFVAKAAAGRADAINTCIGCNQACLDHVFSLQITSCLVNPR
ACHETELVLSPTRARKRVAVVGAGPAGLACSVTAAERGHTVTLFDTADEIGGQLNVARRV
PGKEEFDETLRYFRTRLAELDIDVRLSTRADAATLDGFDEVVLATGVEPRTPAIPGTDHP
KVLSYLDVLRDGATVGDRVAIVGAGGIGFDVAEFLTDGGEAASLDPDAFFRQWGVDTAYE
DRGGLRAPERPESPRTVHLIQRRTTKVGAGLGRTTGWIHRTELRHRGVEMIAGASYDLID
DEGLHLTVDGERRVLPVDTVVLCAGQEPRRDLYEELRAGAVPVHLIGGADVAAELDAKRA
IRQGTELAAAL
Download sequence
Identical sequences B1VSV0
WP_012378098.1.20467 WP_012378098.1.58927 WP_012378098.1.60218 WP_012378098.1.6712 gi|182434618|ref|YP_001822337.1| 455632.SGR_825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]