SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182434816|ref|YP_001822535.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|182434816|ref|YP_001822535.1|
Domain Number - Region: 130-199
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000807
Family PriA-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|182434816|ref|YP_001822535.1|
Sequence length 345
Comment hypothetical protein SGR_1023 [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MGAAVELDAGGRAVRLSNPDKVYFPQKGYTKRDVAEYFLAVGPGITRALNHRPTTLQRFV
DGVEGDFFYQKRAPKNLPEWIPTARIAFPSGRPADEICPTELAAVIWAANLGTLTFHPWP
VRAGDTDHPDELRIDLDPQPGTDYADAVTAAHELRSVLEDHGVRGWPKTSGGRGMHVFVP
IEPAWTFVEVRRAAIAAGRELERRMPERVTTAWWKEERGERIFVDFNQTARDRTIASAYS
VRPFPHAPVSAPLRWEEIDDAEPRDFDIRTLPVRYAELGDVHADMDQEAFRLDALLESAD
RDERERGLGDMPYPPEYPKMPGEPKRVQPSRARHDENDDGDGGAA
Download sequence
Identical sequences B1VU08
gi|182434816|ref|YP_001822535.1| 455632.SGR_1023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]