SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182435143|ref|YP_001822862.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182435143|ref|YP_001822862.1|
Domain Number 1 Region: 223-509
Classification Level Classification E-value
Superfamily Subtilisin-like 3.67e-81
Family Subtilases 0.00000286
Further Details:      
 
Domain Number 2 Region: 778-889
Classification Level Classification E-value
Superfamily PA domain 0.000000327
Family PA domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|182435143|ref|YP_001822862.1|
Domain Number - Region: 99-124
Classification Level Classification E-value
Superfamily PA2021-like 0.0222
Family PA2021-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|182435143|ref|YP_001822862.1|
Sequence length 1252
Comment peptidase [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MTSSPSSVPGRARSARPGRRALLLATSAALLGGMLVPFAGAAGAAPAPRDGTPRPETRAE
SHTVTLITGDVVRYVDGPGDRDTVSVDRPDGAEGGVRVQQAGEDVYVLPDEAAALIAAGA
LDRRLFNVSALVRMGYDDENAGSVPLIATYPPARAKALPAAPRGAKKVRTLASVHGAALS
ADKDGARTFWDAVTSAPSARSLDGGIAKLWLDGRSEALLADSVPQVNAPQAWAAGFDGKG
AKVAVLDTGIDADHPDVKDRVVGARSFVPGEEVDDRNGHGTHVASTIAGSGAASDGAAKG
VAPAADLLVGKVLSDEGSGADSGIIAAMEWAKAEGADVVSMSLGSPVPDDGTDPMSQAVN
SLSADGGPLFVIAAGNAYGAGTIGSPGSAEQALTIAAVDKRDGRADFSSMGPLVRSHGLK
PDLSAPGVDINAAASQSVPGIEGMYQSMSGTSMATPHVAGAAAILKQRHPDWSGQRIKDA
LMSSSAKLDAYTPYEQGTGRLDVKAAIDTTVEATGSVPVASYDWPHSPSDPVAERTVTYR
NSGDTDVTLNLATDTDEAAYTLSTDTLTVPAGGTAEAVLSLDPAKVANDTTFSGQVVATD
AAGTTVAHTGFALTKEKELHDLTVKLRDRSGKPMDGLVVLAELGDPQLGLVQVSGGETTL
RLPPGNYTAWASVDIDGDRPDSRALAFLAAPEILLTGSTAVTLDASKARRIDVRTPKETE
TRQLRYDMARTAPDGTVQRDAYQIPLTYDQLWASPTEKVTQGDFSFLTRWRQGEELIDVE
ADGRDVPVFVQGGAAVAEDSSRKLTAVYAGKGTPAEYRGVNARGRAVVITRSAGVAPAER
LAAALAAGAEALFVVNDERGVAMESYTPYGEETTIPVASVQASAGEGLIRAAQRGKKVRI
DQKRFADYLYDLVDRHDGTIPDRSLAFAPSARQLAKVENTFYGHGKTLGGGYRYDIPDYG
PGVGFEEYERFPDVRTEWVNPLPGDSFWYENHAVLNADGADRAHEMRSAELDYRAGQDYR
AEWFAPVTRPRLGTGYWGPFRTVNNDVQFNITPWTDAGAGHAGSMPENEYDTTSYAFHQG
DKVLKKGPGRAGYVWDLPAGKLPYRLVIDAERDAETWKTSTRTHTEWGFVSGALETGGPQ
QADIPLLQLDYAVDTDLAGDVRAGRSTEIGLSATTQEWLPGAVKANKAALSVSYDDGGSW
TEVALRKKRTGEWTAEFRTPSKGATSVSLKAHAEGPGGLVVDQEIIRAFGLK
Download sequence
Identical sequences B1VVJ5
455632.SGR_1350 gi|182435143|ref|YP_001822862.1| WP_012378471.1.58927 WP_012378471.1.60218 WP_012378471.1.6712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]