SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182435337|ref|YP_001823056.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182435337|ref|YP_001823056.1|
Domain Number 1 Region: 512-734
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.31e-31
Family Laminin G-like module 0.06
Further Details:      
 
Domain Number 2 Region: 106-271
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.00000000366
Family Nitrous oxide reductase, N-terminal domain 0.022
Further Details:      
 
Domain Number 3 Region: 412-506
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000972
Family Fibronectin type III 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|182435337|ref|YP_001823056.1|
Sequence length 737
Comment hypothetical protein SGR_1544 [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MRAASAALGLLAGALTATAAGTSPAAALTPPVAITADDLTTWQTNGIVWSMAAGDGVVYA
GGTFSTLRPPAAAPGTDEQPAVNFAAFDAATGAPTDCSLSFTVSSGTATVRSLALSPDGD
TLYAGGQFGAVNGVGVSNIAAIDTETCTVRNNFKIGVSATVRGLAVTDDTVYLAGDFTTV
GGQTRSHFAAVTTGASLLPFTANADEVARAVEVTPDGRHVLLGGDFFRINGTNTHALAVV
DATSGQLAKSYPGFIHNNSTVQDITTDATGFYTGNEGTGGGVFDGRIALDLDDFEQRWRD
TCLGATQAVLVHSGVLYSGSHAHDCASMGAFPDQPRKHLLAQSVDDPKLLPWFPDTNDGI
GEPVGPRVMSQVSSGGSHYLWVGGEFTTVNSRPQQGLTRFADGPDTGSPWVPNVSLSTLT
PGRIDVNWQTSFDTDDGELTYRIYKDGSNTPVHTTTGYSVFWDRPQLTWTDTDVAPGETH
SYRITASDGTNTSAKSPAQSATVASTAEAYPARVRSDGATLYWRYDEGTSTFAHDSSGNL
NNGFLRNGPAYQQTPAAVAGPSTAIGFNGADDYAFGNRLHAAPGRFSVETWIRTTTRNGG
KIIGFGNKTQQNSTRQDKNVYMRNDGRLVFGVQSNGARTISTSSAYNDGQWHHVVATQGP
LGQGMALYVDGQLRASNILVSGNDGNPGYWRVGGDTLSGWPSRPTSDFFAGQIDETAVYP
TTLSGSQVSAHYALRNG
Download sequence
Identical sequences B1VWP7
455632.SGR_1544 gi|182435337|ref|YP_001823056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]