SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|182435756|ref|YP_001823475.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182435756|ref|YP_001823475.1|
Domain Number 1 Region: 127-285
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.19e-20
Family Rob transcription factor, C-terminal domain 0.045
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000017
Family AraC type transcriptional activator 0.014
Further Details:      
 
Domain Number 3 Region: 62-106
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000627
Family AraC type transcriptional activator 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|182435756|ref|YP_001823475.1|
Sequence length 290
Comment AraC family transcriptional regulator [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MLERLNEAMEHIEAHLGERVEAAELARIAMTSEYHFRRMFSALAGLPLSDYVRRRRMTVA
GAEVLGAPDRTLLDVAVRYGYDTGEGFARAFRAVHGIGPGEARRSGAVLRSQQRLTFRLV
VEGSTAMQYRLVEKDAFRVVGRRARVPLVHEGPNPAIAEFIRGIGREELDRIAALSDQDP
AGLVGVSDQLDPSRAEGTELDYYHGVVSGAEPPEDLDSLSVPAGSWAVFENEGEFPGALQ
YLWRDVFTQWFPSNPYVSRPGPEILRVRLTEEGKRAEAELWIPVERSPGT
Download sequence
Identical sequences B1VZ37
455632.SGR_1963 WP_012378887.1.20467 WP_012378887.1.58927 WP_012378887.1.60218 WP_012378887.1.6712 gi|182435756|ref|YP_001823475.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]