SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182435953|ref|YP_001823672.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182435953|ref|YP_001823672.1|
Domain Number 1 Region: 251-518,578-620
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.58e-80
Family Type II chitinase 0.00000342
Further Details:      
 
Domain Number 2 Region: 48-150
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 9.77e-32
Family Cellulose-binding domain family II 0.00031
Further Details:      
 
Domain Number 3 Region: 157-241
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000162
Family Fibronectin type III 0.00028
Further Details:      
 
Domain Number 4 Region: 520-579
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000000128
Family Chitinase insertion domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|182435953|ref|YP_001823672.1|
Sequence length 623
Comment chitinase III [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MSTDTPQRRSRFRWIPVRSGRAKVVAGLTALVVPLAAMVGLAAPASAATSATATYTKKSD
WGSGFEGQWTVKNTGTTALSSWTIEWDFPSGTTAGSAWDATLTSSGGHYTAKNLSWNGSV
APGASISFGFNGTGSGSPTGCKLNGASCDGGSVPGDNAPSAPGTPTTSDVTNTSVKLSWS
AATDDKGVKNYDVLRDGAKIATVTGTTYTNTGLTAGTDYSYAVQARDTADQTGPVSGAVS
VRTTGGGGEQPGGDKVNLGYFTNWGVYGRNYHVKNLVTSGSAAKITHINYAFGNVQNGKC
TIGDSYADYEKAYTADQSVDGVADTWDQPLRGNFNQLRKLKAKYPHIKILWSFGGWTWSG
GFGQAVQNPAAFAQSCYDLVEDPRWADVFDGIDLDWEYPNACGLTCDTSGPAALKTMADA
MRAKFGTKNLVTAAITADGSNGGKIDAADYGGASQSFDWYNVMTYDFFGAWAAKGPTAPH
SPLTPYTGIPQAGFSSSEAIAKLKAKGVPAKKLLLGIGFYGRGWTGVTQSAPGGTATGAA
PGTYEAGNEDYKVLKATCPSNGTIAGTAYAHCGTNWWSYDTPATIGTKMTWAKNQGLGGA
FFWEFSGDTTNGELVNAIKTGLQ
Download sequence
Identical sequences B1W0A0
gi|182435953|ref|YP_001823672.1| WP_012379016.1.58927 WP_012379016.1.60218 WP_012379016.1.6712 455632.SGR_2160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]