SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182436251|ref|YP_001823970.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182436251|ref|YP_001823970.1|
Domain Number 1 Region: 47-350,418-457
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.38e-88
Family Type II chitinase 0.000000122
Further Details:      
 
Domain Number 2 Region: 352-420
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000153
Family Chitinase insertion domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|182436251|ref|YP_001823970.1|
Sequence length 465
Comment chitinase [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MRRRNLTRLTTAAVALALLGGIAPAATASSGHDRDNGGDRDKGHHRPAYKSVGYFTQWGI
YGRDFQVKDLDTSGAAAKLTHINYAFGNVNAEGKCFTGNIPGQADAWADYARPLDAAGSV
DGVADTDTQPLAGNFNQLRELKAKHPGLKVMISLGGWSYSTHFSDAVRTEASRKALVASC
VDLYIKGNLPVDGARGGQGAAAGLFDGIDVDWEWPGSPGNEGTVYRPEDKKNFTALIHEF
RTQLDAYAKSRAKAAEGKGHGHGKPKPKHYDLSAYVAANPKAIDAGFDVKRLMKDFDFVN
IQGYDYHVSGEKKTAQQSALYAKNDFSVDQTVRDWVRRGAPKHKIVVGMPTYGQGWTGVT
GGGTGMGQPATAPAPATWAAGYEDYKVLKQLAASGTYKIHRDVKNGHAWLFDGKTLWTYD
DPQVLRTKASYIRDKGLGGAMFWSLDGDTENGELITAVDRGLNRR
Download sequence
Identical sequences B1W2C3
gi|182436251|ref|YP_001823970.1| 455632.SGR_2458 WP_012379213.1.20467 WP_012379213.1.58927 WP_012379213.1.60218 WP_012379213.1.6712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]