SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182436697|ref|YP_001824416.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182436697|ref|YP_001824416.1|
Domain Number 1 Region: 2-195
Classification Level Classification E-value
Superfamily Prim-pol domain 1.37e-34
Family Bifunctional DNA primase/polymerase N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|182436697|ref|YP_001824416.1|
Sequence length 294
Comment hypothetical protein SGR_2904 [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MNTLLNAALDAAERGWHVFPLRPADKRPALHGETACSGTGDCAGGHRKWEQRATTDPDRI
RAAWSAGAFNVGLATGPSGLVVVDLDPVKAKDPKGTPDGVTSLQALCERAGQTVPATYRT
RTASGGHHLYFTAPPGVRLGNSAGRLGKHIDTRAHGGYVVAAGSTLPNGAYEVVNPTDPV
PLPEWLYALLAPRQPSRGLMAVPVPVRASRYAAAALRAETAAVAGAGEGVRNWTLVRAAR
ALGRFIPSGDLDRSEVEAALNSAGLRAGLRENECRAAVASALNWSIANNPGRPA
Download sequence
Identical sequences B1W4T9
gi|182436697|ref|YP_001824416.1| WP_012379504.1.20467 WP_012379504.1.58927 WP_012379504.1.60218 WP_012379504.1.6712 455632.SGR_2904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]