SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182437389|ref|YP_001825108.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|182437389|ref|YP_001825108.1|
Domain Number - Region: 55-150
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000347
Family Bifunctional DNA primase/polymerase N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|182437389|ref|YP_001825108.1|
Sequence length 277
Comment hypothetical protein SGR_3596 [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MSEHLRTALTLAAHGVPPLPLRVGKVPFGNCPTCARNACGGRPNMKTPGPCTCSQPCHGW
AAATTDPNVINSTPWERAWRKAAGVAYHPGGAGVTVVDLDNAKAIAWARASLPATRTVPT
TRGEHWIYRGIMQGANGVRPGVDIKSTMAYARWLGPGAGTMAALPDVVRALTVKAPAPAR
PVAVTVPASSASGVCPHRTPTYLDRGIAMAEQRITEAREAVHATVYRAFLAVLSTHGRCG
CLTETHTARLFTAAQAKGESARHCTEAWTNALTTLGL
Download sequence
Identical sequences B1VP46
WP_012380014.1.20467 WP_012380014.1.58927 WP_012380014.1.60218 WP_012380014.1.6712 gi|182437389|ref|YP_001825108.1| 455632.SGR_3596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]