SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182437403|ref|YP_001825122.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182437403|ref|YP_001825122.1|
Domain Number 1 Region: 13-221
Classification Level Classification E-value
Superfamily Prim-pol domain 1.31e-30
Family Bifunctional DNA primase/polymerase N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|182437403|ref|YP_001825122.1|
Sequence length 319
Comment hypothetical protein SGR_3610 [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MATIDRQTPALALAHALAAAGRGLPVFPLSATKLPALRSPHRGEQSPTHCRCRGECGLPG
HGVHDATTDPAAVRALFAAAPRATGYGIACGRAPHRLIGVDLDIDPSYGSDAAGALRQLG
LQHLFTIPPTVTVLTPSGGRHLWLTGPADATVPNSAGRLAPGIDIRGSGGYLVGPGSVTT
HGRYRLAPGTAHLTPAPCPRALLRLLTPPPGRASRTGRGPAPGGASGPGTGPGPGSPVTA
ARRGEGLIQFVLAAHEGQRNTRLFWAACRAYEHGFGDALADGLTAAAVRTGLPEHEARAA
IASAARLTQGRGEEHHGAA
Download sequence
Identical sequences B1VP60
455632.SGR_3610 gi|182437403|ref|YP_001825122.1| WP_012380027.1.58927 WP_012380027.1.6712 WP_012380027.1.97807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]