SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182437518|ref|YP_001825237.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182437518|ref|YP_001825237.1|
Domain Number 1 Region: 7-274
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-77
Family Protein kinases, catalytic subunit 0.0000000317
Further Details:      
 
Weak hits

Sequence:  gi|182437518|ref|YP_001825237.1|
Domain Number - Region: 449-507
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000484
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number - Region: 381-442
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|182437518|ref|YP_001825237.1|
Sequence length 664
Comment serine/threonine protein kinase [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MEEPRRLGGRYELGSVLGRGGMAEVYLAHDTRLGRTVAVKTLRADLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYVDGVSIPYIVMEYVDGSTLRELLHSGRRLLPERTLEMTV
GILQALEYSHRAQIVHRDIKPANVMLTRTGQVKVMDFGIARAMGDSGMTMTQTAAVIGTA
QYLSPEQAKGEQVDARSDLYSTGCLLYELLAVRPPFVGDSPVAVAYQHVREEPQPPSNFD
PEITPEMDAIVLKALTKDPDYRYQSADEMRADIEACLDGQPVAATAAMGAAGYGGYDGYN
PDQPTTALRPTDPNNAQTSMLPPVNPDDGGYGYDDRQGRRRQQKKSNTSTILLVVAGILV
LIGAILIGRVMFSPADDDGQVNAPNLVGSTVQQAEKLAARTDVTVKVGAEEPCEEQEKGE
ICSQDPAADALMDKNGTVTVVVSAGAPKIEIPNVLEKSEDGAREELEKKGFTVNVTTEES
EKTEGTVIQQDPKGGEKAEDGSEITITVAVQATDPMPDVRTRQYDAAVAQLNQLGFTNVS
RADVDSDKPAGEVIEQTPAGPSKQAKDAQIVLKVSKGPAQPEQVQIPGDIGNRPYQDVKG
QLEGLGFVVALAPNSVDKPNARVITSTPAPTTQAPKGSTVTLVTIEGGGNGGNGGFIGGL
GGDD
Download sequence
Identical sequences B1VQQ3
WP_012380097.1.20467 WP_012380097.1.29035 WP_012380097.1.58927 WP_012380097.1.60218 WP_012380097.1.6712 WP_012380097.1.9539 455632.SGR_3725 gi|182437518|ref|YP_001825237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]