SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182438160|ref|YP_001825879.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|182438160|ref|YP_001825879.1|
Domain Number - Region: 40-101
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0471
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|182438160|ref|YP_001825879.1|
Sequence length 109
Comment hypothetical protein SGR_4367 [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MSEPHTSEPHRSDLHKEVSELERKSATAARLFDIRRIIGGLFVVYGVIVTIAGISPSDAD
LEKAEGVHINLWTGLAMLALGLFFLVWMKLRPAEAPETAPDPKPGPDGG
Download sequence
Identical sequences B1VUH0 G0Q246
gi|182438160|ref|YP_001825879.1| 455632.SGR_4367 WP_003968572.1.20467 WP_003968572.1.29035 WP_003968572.1.51792 WP_003968572.1.58927 WP_003968572.1.60218 WP_003968572.1.6712 WP_003968572.1.9539 WP_003968572.1.97807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]