SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182439881|ref|YP_001827600.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182439881|ref|YP_001827600.1|
Domain Number 1 Region: 67-383,498-530
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.85e-77
Family Type II chitinase 0.0000331
Further Details:      
 
Domain Number 2 Region: 734-785
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.000000000000135
Family Carbohydrate binding domain 0.0026
Further Details:      
 
Domain Number 3 Region: 383-496
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000000165
Family Chitinase insertion domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|182439881|ref|YP_001827600.1|
Sequence length 785
Comment chitinase [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MLSPTRARATLLAAGAAVAGLLMTSLAATPSAAATDHESCRPDGLYKTPGADTAYCTVYD
GEGREKMGADHKRRVIGYFTNWRTGKDGKDAYLVPNIPWDKVTHLNYAFAHVDSSNKLSV
GPDSADNASTGMTWPGVAGAEMDPTLPYKGHFNLLTKYKKQHPDVKTLVSVGGWAETGGY
FGPDGKRVNSGGFYSMATNADGSVNQTGINTFADSAVTFIKKYGFNGVDIDYEYATSMKD
AGNPMDHTLANGRRAGLVKGYDALMKTLREKLDRAGAADGKHYLLTVAAPSSGYLLRGME
TYQMQKYLDYVNIMSYDLHGAWNEYVGPNAQLFDDGKDNELAQAGVYTTSQYGGVGYLNT
DWAYHYFRGSMPAGRINIGLPYYTRGFKNVQGGTDGLWGKAATTTCPAGAGLTKCGDGAV
GIDNLWHDKDDNGKESPAGSNPMWHAKNLEKGIAGDYLASYGFPANTQLTGTYVRKYDST
LVAPWLWNAQKKVFLSTEDEQSVKAKADYVVDKGIGGTMIWELAGDYRWNATKGQYETGD
TLTTAMYDAFKSAAPYGAKRSTVTLPTEAVNIDVSFNQFALGDSNYPISPKLKITNRTQA
TLPGGTEFQFDYSTSAPANAKDQSGFGTSIVRSDHTAANNVGGLKGPYNRVSLKLPAWQT
LAPGASVELDFVYYLPTSTPSNWTVTFGGKSYSLTGDLARGTTVVEPGTGTNPTPTPTPT
GPTPTPTPTQPGGSCTAPAWNAATEYGGGSTVSHGGHQWKASWWTKGETPGSAGQWGAWK
DLGAC
Download sequence
Identical sequences B1W4A0
WP_012381705.1.20467 WP_012381705.1.58927 WP_012381705.1.60218 WP_012381705.1.6712 455632.SGR_6088 gi|182439881|ref|YP_001827600.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]