SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|182440317|ref|YP_001828036.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182440317|ref|YP_001828036.1|
Domain Number 1 Region: 194-315
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 7.36e-47
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.0000127
Further Details:      
 
Domain Number 2 Region: 3-188
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.6e-33
Family ETFP subunits 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|182440317|ref|YP_001828036.1|
Sequence length 320
Comment electron transfer flavoprotein subunit alpha [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MAEVLVLVDHVDGAVRKPTLELLTLARRIGDPVAVALGAGAESTAGVLGEHGAVKVLASD
APEFADYLVVPKVDALQAAFEAVSPAAVLVVSSAEGKEIAARLALRIGSGIITDATDLEA
GDEGPVATQAVFAASYTTRSRVSRGVAVITVKPNSAPVEPAAAAGAVEALAVSFGEGATG
TKVVSRTPRESTGRPELTEAAIVVSGGRGVNGAENFPLIEALADSLGAAVGASRAAVDAG
WYPHTSQVGQTGKSVSPQLYIASGISGAIQHRAGMQTSKTIVAINKDAEAPIFELVDYGV
VGDLFAVVPQLTEEINTRKG
Download sequence
Identical sequences B1VLG2
gi|182440317|ref|YP_001828036.1| WP_012382003.1.58927 WP_012382003.1.6712 455632.SGR_6524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]