SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182440493|ref|YP_001828212.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182440493|ref|YP_001828212.1|
Domain Number 1 Region: 283-421
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 4.45e-30
Family Oxidoreductase molybdopterin-binding domain 0.00065
Further Details:      
 
Weak hits

Sequence:  gi|182440493|ref|YP_001828212.1|
Domain Number - Region: 78-190
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.000608
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|182440493|ref|YP_001828212.1|
Sequence length 423
Comment hypothetical protein SGR_6700 [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MPERRRLRSLPDSLRAARTPADPAFWRSPVRGARFTAVLGVILLAGLTLLFVTGLLSYAA
YNPDLNRVNDKTPDKGLLGFYLFSWPTGPHWLYRLTQGLHVTVGIVLVPVLLAKLWSVVP
RLFALPPARSAGHALERLSLLLLVGGALFQFVTGLLNIQLDYLFPGSFYTLHFYGAWVFL
AGFITHVALKTPRAVRVLRAGVPRGEADTLAAPDPLPATLSRRGALALVGAASLLLLVTS
AGRSFDGPLRRIALLTPRGGTDPGPGPNAFQINKTAAAVRIRPADTGERWRLTVRGPAGE
FRFSRAELLAMDLHSAALPIACVEGWSTSDQQWRGVRLLDLAALAGYPDRPPGVFVESLQ
RGGSFRKAALRDNQVRDGRSLLALEVNGAPLSADHGYPARIIVPAAPGVLNTKWVETLTF
GEL
Download sequence
Identical sequences B1VMQ4
455632.SGR_6700 WP_012382138.1.20467 WP_012382138.1.58927 WP_012382138.1.60218 WP_012382138.1.6712 gi|182440493|ref|YP_001828212.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]