SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182438525|ref|YP_001826244.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182438525|ref|YP_001826244.1|
Domain Number 1 Region: 145-361,398-532
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.32e-42
Family AAT-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|182438525|ref|YP_001826244.1|
Sequence length 554
Comment aspartate aminotransferase [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MDTTMPKTRISREEIRSFAQLSPFELKDKFIQIATAAQSDQPGQKGKSTRTMLNAGRGNP
NWVATGPREAYHALGYFAIAESRRVWTADNLGGMPEESGCSERFEHFVRTHPELPGIELL
KASVDLAVKRFGFDRDAFVHELADSSIGDNYPVPDRILHHTEQIVRGYIADEMFDHRPPE
GQTLSLFATEGGTAAMCYVFDSLMKNGILAKGDRIALMVPVFTPYLEIPELDTYDFDVVR
VEASLFTETGVRQWRYPEEEIAKLADPSIRMVCCVNPSNPPSLALSTRVAEQIVSIVGER
NPNLIIVTDDVYGTFVEGFRSLAADLPRNTLLVYSYSKHYGATGWRLGVIALHDDNVIDA
MLREQGAEQRERLNRRYGTLSLEPEKMRFIDRMVADSRQVALNHTAGLSLPQQVMMALFS
LFDMLDEGQAYKHRVRAIVRQRLELLLEGVHMKVSEDPKRAAYYIELDLLAEAERVHGKP
FADFLEKNYEPVDPLFRLAEQTSVVLLNGGGFDGPEWSVRVSLANLDDLDYLKIGHHLRA
IFDAYAEEWRAQAG
Download sequence
Identical sequences B1VW50
455632.SGR_4732 gi|182438525|ref|YP_001826244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]