SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167646172|ref|YP_001683835.1| from Caulobacter sp. K31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167646172|ref|YP_001683835.1|
Domain Number 1 Region: 6-98
Classification Level Classification E-value
Superfamily YccV-like 1.7e-35
Family YccV-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167646172|ref|YP_001683835.1|
Sequence length 109
Comment hemimethylated DNA-binding protein [Caulobacter sp. K31]
Sequence
MNSRTAKFAIGQVVKHRIFPFRGVVFDVDPVFANTEEWWNSIPEDIRPTKDQPFYHLLAE
NDDNTYVAYVSEQNLLADETGEPVGHPQTAVIFESFDHGAYKLRPRISH
Download sequence
Identical sequences B0T8J4
WP_012286247.1.20905 gi|167646172|ref|YP_001683835.1| 366602.Caul_2209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]