SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167648715|ref|YP_001686378.1| from Caulobacter sp. K31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167648715|ref|YP_001686378.1|
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily YggU-like 4.05e-21
Family YggU-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167648715|ref|YP_001686378.1|
Sequence length 96
Comment hypothetical protein Caul_4760 [Caulobacter sp. K31]
Sequence
MRLAVRLTPRGGREAIDGWAVDGDGRPYLKVRVAAPPVEGAANAALLAFLAKALGLPKSA
LTLASGAGARLKLIEIAGCDPLSLERVLGRPPEADR
Download sequence
Identical sequences B0T3Z6
gi|167648715|ref|YP_001686378.1| WP_012288751.1.20905 366602.Caul_4760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]