SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470194341|ref|YP_007580693.1| from Staphylococcus aureus ST228/16035

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470194341|ref|YP_007580693.1|
Domain Number 1 Region: 45-312
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.43e-51
Family Transferrin 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470194341|ref|YP_007580693.1|
Sequence length 318
Comment Alkylphosphonate ABC transporter [Staphylococcus aureus subsp. aureus ST228]
Sequence
MKNFKYLFVLMLAVIVFAAACGNSSSLDNQKNASNDSDSKSGGYKPKELTVQFVPSQNAG
TLEAKAKPLEKLLSKELGIPVKVSVSTNYNTIVEAMKSKKVDVGFLPPTAYTLAHDQKAA
DLLLQAQRFGVKEDGSASKELVDSYKSEILVKKDSKIKSLKDLKGKKIALQDVTSTAGYT
FPLAMLKNEAGINATKDMKIVNVKGHDQAVISLLNGDVDAAAVFNDARNTVKKDQPNVFK
DTRILKLTQAIPNDTISVRPDMDKDFQEKLKKAFIDIAKSKEGHKIISEVYSHEGYTETK
DSNFDIVREYEKLVKDMK
Download sequence
Identical sequences A0A0H3JL22 A0A0H3JPG1 A0A1Q4H144
gi|470223830|ref|YP_007622409.1| gi|470218042|ref|YP_007618436.1| gi|269201795|ref|YP_003281064.1| gi|470221865|ref|YP_007620422.1| gi|470192376|ref|YP_007578729.1| gi|15923133|ref|NP_370667.1| WP_000787777.1.10014 WP_000787777.1.100171 WP_000787777.1.100184 WP_000787777.1.100235 WP_000787777.1.10032 WP_000787777.1.100366 WP_000787777.1.100399 WP_000787777.1.10046 WP_000787777.1.100464 WP_000787777.1.10050 WP_000787777.1.100535 WP_000787777.1.100562 WP_000787777.1.100582 WP_000787777.1.100596 WP_000787777.1.100693 WP_000787777.1.100699 WP_000787777.1.100704 WP_000787777.1.100719 WP_000787777.1.100823 WP_000787777.1.100832 WP_000787777.1.100860 WP_000787777.1.100888 WP_000787777.1.100934 WP_000787777.1.10097 WP_000787777.1.101002 WP_000787777.1.101019 WP_000787777.1.101027 WP_000787777.1.101068 WP_000787777.1.101071 WP_000787777.1.101072 WP_000787777.1.101103 WP_000787777.1.10111 WP_000787777.1.101160 WP_000787777.1.101192 WP_000787777.1.101379 WP_000787777.1.101414 WP_000787777.1.101440 WP_000787777.1.101441 WP_000787777.1.10148 WP_000787777.1.101567 WP_000787777.1.10165 WP_000787777.1.101661 WP_000787777.1.101691 WP_000787777.1.101704 WP_000787777.1.101728 WP_000787777.1.101745 WP_000787777.1.101778 WP_000787777.1.101813 WP_000787777.1.101820 WP_000787777.1.101825 WP_000787777.1.101852 WP_000787777.1.101902 WP_000787777.1.101906 WP_000787777.1.101943 WP_000787777.1.102065 WP_000787777.1.102096 WP_000787777.1.102123 WP_000787777.1.102130 WP_000787777.1.102132 WP_000787777.1.10238 WP_000787777.1.1025 WP_000787777.1.10274 WP_000787777.1.1031 WP_000787777.1.10343 WP_000787777.1.1043 WP_000787777.1.10436 WP_000787777.1.10478 WP_000787777.1.10481 WP_000787777.1.10526 WP_000787777.1.10624 WP_000787777.1.10749 WP_000787777.1.10751 WP_000787777.1.1077 WP_000787777.1.10823 WP_000787777.1.10858 WP_000787777.1.10919 WP_000787777.1.10942 WP_000787777.1.10976 WP_000787777.1.11001 WP_000787777.1.11069 WP_000787777.1.11073 WP_000787777.1.11083 WP_000787777.1.11084 WP_000787777.1.1115 WP_000787777.1.11162 WP_000787777.1.11220 WP_000787777.1.11261 WP_000787777.1.11282 WP_000787777.1.11286 WP_000787777.1.11322 WP_000787777.1.11333 WP_000787777.1.11378 WP_000787777.1.11403 WP_000787777.1.11447 WP_000787777.1.11451 WP_000787777.1.1147 WP_000787777.1.11504 WP_000787777.1.11513 WP_000787777.1.11556 WP_000787777.1.11640 WP_000787777.1.11646 WP_000787777.1.11663 WP_000787777.1.1171 WP_000787777.1.11730 WP_000787777.1.11736 WP_000787777.1.11768 WP_000787777.1.11837 WP_000787777.1.11884 WP_000787777.1.11903 WP_000787777.1.12019 WP_000787777.1.12042 WP_000787777.1.1210 WP_000787777.1.12149 WP_000787777.1.12152 WP_000787777.1.12170 WP_000787777.1.12175 WP_000787777.1.12234 WP_000787777.1.12256 WP_000787777.1.12437 WP_000787777.1.12508 WP_000787777.1.1257 WP_000787777.1.12598 WP_000787777.1.12608 WP_000787777.1.12618 WP_000787777.1.12685 WP_000787777.1.12733 WP_000787777.1.12737 WP_000787777.1.12770 WP_000787777.1.12780 WP_000787777.1.12788 WP_000787777.1.12829 WP_000787777.1.12858 WP_000787777.1.12904 WP_000787777.1.12918 WP_000787777.1.12920 WP_000787777.1.13013 WP_000787777.1.13062 WP_000787777.1.13154 WP_000787777.1.13169 WP_000787777.1.13189 WP_000787777.1.13243 WP_000787777.1.13250 WP_000787777.1.13326 WP_000787777.1.13355 WP_000787777.1.13379 WP_000787777.1.13405 WP_000787777.1.13448 WP_000787777.1.13514 WP_000787777.1.13554 WP_000787777.1.13612 WP_000787777.1.13665 WP_000787777.1.13670 WP_000787777.1.13879 WP_000787777.1.13897 WP_000787777.1.13933 WP_000787777.1.13987 WP_000787777.1.14025 WP_000787777.1.14097 WP_000787777.1.14143 WP_000787777.1.14163 WP_000787777.1.1420 WP_000787777.1.14201 WP_000787777.1.1425 WP_000787777.1.1429 WP_000787777.1.14305 WP_000787777.1.14342 WP_000787777.1.14358 WP_000787777.1.14397 WP_000787777.1.14412 WP_000787777.1.14535 WP_000787777.1.14577 WP_000787777.1.14596 WP_000787777.1.14639 WP_000787777.1.14696 WP_000787777.1.1471 WP_000787777.1.14729 WP_000787777.1.14734 WP_000787777.1.14774 WP_000787777.1.14825 WP_000787777.1.14846 WP_000787777.1.14967 WP_000787777.1.14970 WP_000787777.1.15015 WP_000787777.1.15029 WP_000787777.1.15108 WP_000787777.1.15173 WP_000787777.1.15185 WP_000787777.1.1520 WP_000787777.1.15201 WP_000787777.1.1525 WP_000787777.1.15268 WP_000787777.1.15269 WP_000787777.1.15294 WP_000787777.1.15296 WP_000787777.1.15533 WP_000787777.1.15544 WP_000787777.1.15546 WP_000787777.1.1558 WP_000787777.1.15590 WP_000787777.1.1564 WP_000787777.1.15691 WP_000787777.1.15722 WP_000787777.1.15785 WP_000787777.1.15812 WP_000787777.1.159 WP_000787777.1.15920 WP_000787777.1.15921 WP_000787777.1.15925 WP_000787777.1.16018 WP_000787777.1.16068 WP_000787777.1.16096 WP_000787777.1.16098 WP_000787777.1.16140 WP_000787777.1.16173 WP_000787777.1.16195 WP_000787777.1.16203 WP_000787777.1.16223 WP_000787777.1.1623 WP_000787777.1.16251 WP_000787777.1.16265 WP_000787777.1.16276 WP_000787777.1.16311 WP_000787777.1.16395 WP_000787777.1.16407 WP_000787777.1.16458 WP_000787777.1.16589 WP_000787777.1.16632 WP_000787777.1.16639 WP_000787777.1.1665 WP_000787777.1.16651 WP_000787777.1.16653 WP_000787777.1.16693 WP_000787777.1.16747 WP_000787777.1.16761 WP_000787777.1.16794 WP_000787777.1.16815 WP_000787777.1.16824 WP_000787777.1.16880 WP_000787777.1.16882 WP_000787777.1.16920 WP_000787777.1.16925 WP_000787777.1.16969 WP_000787777.1.17046 WP_000787777.1.17080 WP_000787777.1.17122 WP_000787777.1.17132 WP_000787777.1.17139 WP_000787777.1.17157 WP_000787777.1.17180 WP_000787777.1.17240 WP_000787777.1.1729 WP_000787777.1.17309 WP_000787777.1.17327 WP_000787777.1.1736 WP_000787777.1.1741 WP_000787777.1.17419 WP_000787777.1.17454 WP_000787777.1.17529 WP_000787777.1.17531 WP_000787777.1.1756 WP_000787777.1.17590 WP_000787777.1.17643 WP_000787777.1.1765 WP_000787777.1.17671 WP_000787777.1.17717 WP_000787777.1.17718 WP_000787777.1.17725 WP_000787777.1.17737 WP_000787777.1.17796 WP_000787777.1.17818 WP_000787777.1.17832 WP_000787777.1.17847 WP_000787777.1.17853 WP_000787777.1.17909 WP_000787777.1.17922 WP_000787777.1.17943 WP_000787777.1.17987 WP_000787777.1.18011 WP_000787777.1.18069 WP_000787777.1.18080 WP_000787777.1.18113 WP_000787777.1.18140 WP_000787777.1.18153 WP_000787777.1.18203 WP_000787777.1.18237 WP_000787777.1.18248 WP_000787777.1.18261 WP_000787777.1.18288 WP_000787777.1.1829 WP_000787777.1.18301 WP_000787777.1.18309 WP_000787777.1.18310 WP_000787777.1.18360 WP_000787777.1.18412 WP_000787777.1.18429 WP_000787777.1.1847 WP_000787777.1.18487 WP_000787777.1.18506 WP_000787777.1.18507 WP_000787777.1.18539 WP_000787777.1.18560 WP_000787777.1.18570 WP_000787777.1.18591 WP_000787777.1.18632 WP_000787777.1.18679 WP_000787777.1.18741 WP_000787777.1.18777 WP_000787777.1.18792 WP_000787777.1.18818 WP_000787777.1.18819 WP_000787777.1.18834 WP_000787777.1.18882 WP_000787777.1.1892 WP_000787777.1.18965 WP_000787777.1.18974 WP_000787777.1.18996 WP_000787777.1.19052 WP_000787777.1.19082 WP_000787777.1.1911 WP_000787777.1.19301 WP_000787777.1.19322 WP_000787777.1.19430 WP_000787777.1.19450 WP_000787777.1.19537 WP_000787777.1.19555 WP_000787777.1.19577 WP_000787777.1.19611 WP_000787777.1.1964 WP_000787777.1.19643 WP_000787777.1.19701 WP_000787777.1.19725 WP_000787777.1.19732 WP_000787777.1.1974 WP_000787777.1.19748 WP_000787777.1.19792 WP_000787777.1.19816 WP_000787777.1.19848 WP_000787777.1.19891 WP_000787777.1.19912 WP_000787777.1.19921 WP_000787777.1.19980 WP_000787777.1.19981 WP_000787777.1.19982 WP_000787777.1.20006 WP_000787777.1.20049 WP_000787777.1.20052 WP_000787777.1.2007 WP_000787777.1.20078 WP_000787777.1.2008 WP_000787777.1.20090 WP_000787777.1.20100 WP_000787777.1.20156 WP_000787777.1.20161 WP_000787777.1.20167 WP_000787777.1.20191 WP_000787777.1.20214 WP_000787777.1.20245 WP_000787777.1.2029 WP_000787777.1.20324 WP_000787777.1.20340 WP_000787777.1.20398 WP_000787777.1.20399 WP_000787777.1.20411 WP_000787777.1.20447 WP_000787777.1.20479 WP_000787777.1.20487 WP_000787777.1.20574 WP_000787777.1.20579 WP_000787777.1.20585 WP_000787777.1.20611 WP_000787777.1.20619 WP_000787777.1.20620 WP_000787777.1.20736 WP_000787777.1.20796 WP_000787777.1.20821 WP_000787777.1.20846 WP_000787777.1.20867 WP_000787777.1.20878 WP_000787777.1.20913 WP_000787777.1.20922 WP_000787777.1.20935 WP_000787777.1.20939 WP_000787777.1.20945 WP_000787777.1.20971 WP_000787777.1.21009 WP_000787777.1.21056 WP_000787777.1.21066 WP_000787777.1.21078 WP_000787777.1.21109 WP_000787777.1.21111 WP_000787777.1.21154 WP_000787777.1.21183 WP_000787777.1.2119 WP_000787777.1.21257 WP_000787777.1.21272 WP_000787777.1.21313 WP_000787777.1.21339 WP_000787777.1.2135 WP_000787777.1.21359 WP_000787777.1.21375 WP_000787777.1.21379 WP_000787777.1.21393 WP_000787777.1.21412 WP_000787777.1.21449 WP_000787777.1.21464 WP_000787777.1.21480 WP_000787777.1.21500 WP_000787777.1.21514 WP_000787777.1.21572 WP_000787777.1.2159 WP_000787777.1.2160 WP_000787777.1.21636 WP_000787777.1.21724 WP_000787777.1.21746 WP_000787777.1.21763 WP_000787777.1.21787 WP_000787777.1.21830 WP_000787777.1.21988 WP_000787777.1.22027 WP_000787777.1.22082 WP_000787777.1.22111 WP_000787777.1.22177 WP_000787777.1.22197 WP_000787777.1.22227 WP_000787777.1.22302 WP_000787777.1.22400 WP_000787777.1.22493 WP_000787777.1.22533 WP_000787777.1.22559 WP_000787777.1.22650 WP_000787777.1.22696 WP_000787777.1.22702 WP_000787777.1.22709 WP_000787777.1.22738 WP_000787777.1.22789 WP_000787777.1.22790 WP_000787777.1.22792 WP_000787777.1.22803 WP_000787777.1.22853 WP_000787777.1.22869 WP_000787777.1.22890 WP_000787777.1.22969 WP_000787777.1.23008 WP_000787777.1.23061 WP_000787777.1.23082 WP_000787777.1.23103 WP_000787777.1.23121 WP_000787777.1.23130 WP_000787777.1.23132 WP_000787777.1.23133 WP_000787777.1.23161 WP_000787777.1.23244 WP_000787777.1.2327 WP_000787777.1.23275 WP_000787777.1.23288 WP_000787777.1.23413 WP_000787777.1.23449 WP_000787777.1.23531 WP_000787777.1.23572 WP_000787777.1.23630 WP_000787777.1.23644 WP_000787777.1.23690 WP_000787777.1.23740 WP_000787777.1.23796 WP_000787777.1.23809 WP_000787777.1.23842 WP_000787777.1.2389 WP_000787777.1.23900 WP_000787777.1.23956 WP_000787777.1.23972 WP_000787777.1.23995 WP_000787777.1.24000 WP_000787777.1.24129 WP_000787777.1.24174 WP_000787777.1.24207 WP_000787777.1.24213 WP_000787777.1.24263 WP_000787777.1.2427 WP_000787777.1.24277 WP_000787777.1.24416 WP_000787777.1.24437 WP_000787777.1.24469 WP_000787777.1.2450 WP_000787777.1.24589 WP_000787777.1.24596 WP_000787777.1.24602 WP_000787777.1.24631 WP_000787777.1.24679 WP_000787777.1.24823 WP_000787777.1.24855 WP_000787777.1.2497 WP_000787777.1.25007 WP_000787777.1.2501 WP_000787777.1.25012 WP_000787777.1.2506 WP_000787777.1.25070 WP_000787777.1.25092 WP_000787777.1.25098 WP_000787777.1.25115 WP_000787777.1.25145 WP_000787777.1.25167 WP_000787777.1.25209 WP_000787777.1.25287 WP_000787777.1.25361 WP_000787777.1.25459 WP_000787777.1.25489 WP_000787777.1.2552 WP_000787777.1.25557 WP_000787777.1.25595 WP_000787777.1.25621 WP_000787777.1.25623 WP_000787777.1.25721 WP_000787777.1.25758 WP_000787777.1.25772 WP_000787777.1.25779 WP_000787777.1.25802 WP_000787777.1.25840 WP_000787777.1.25856 WP_000787777.1.25857 WP_000787777.1.2590 WP_000787777.1.25910 WP_000787777.1.25930 WP_000787777.1.26039 WP_000787777.1.2608 WP_000787777.1.26086 WP_000787777.1.26106 WP_000787777.1.26143 WP_000787777.1.26169 WP_000787777.1.2621 WP_000787777.1.26255 WP_000787777.1.26266 WP_000787777.1.26276 WP_000787777.1.26290 WP_000787777.1.26298 WP_000787777.1.26314 WP_000787777.1.26318 WP_000787777.1.26340 WP_000787777.1.26345 WP_000787777.1.26354 WP_000787777.1.26359 WP_000787777.1.26364 WP_000787777.1.26399 WP_000787777.1.26404 WP_000787777.1.2643 WP_000787777.1.26506 WP_000787777.1.26662 WP_000787777.1.26677 WP_000787777.1.26692 WP_000787777.1.2673 WP_000787777.1.26751 WP_000787777.1.26772 WP_000787777.1.26804 WP_000787777.1.2684 WP_000787777.1.26840 WP_000787777.1.26865 WP_000787777.1.26884 WP_000787777.1.2689 WP_000787777.1.26903 WP_000787777.1.26905 WP_000787777.1.26938 WP_000787777.1.26944 WP_000787777.1.27013 WP_000787777.1.27053 WP_000787777.1.27083 WP_000787777.1.27166 WP_000787777.1.27170 WP_000787777.1.27182 WP_000787777.1.2719 WP_000787777.1.27262 WP_000787777.1.27293 WP_000787777.1.27294 WP_000787777.1.27323 WP_000787777.1.27379 WP_000787777.1.27387 WP_000787777.1.27447 WP_000787777.1.27456 WP_000787777.1.27468 WP_000787777.1.2753 WP_000787777.1.27539 WP_000787777.1.27590 WP_000787777.1.27628 WP_000787777.1.27646 WP_000787777.1.27689 WP_000787777.1.27739 WP_000787777.1.27744 WP_000787777.1.27793 WP_000787777.1.27830 WP_000787777.1.2795 WP_000787777.1.28016 WP_000787777.1.28091 WP_000787777.1.28105 WP_000787777.1.28173 WP_000787777.1.28213 WP_000787777.1.28230 WP_000787777.1.28253 WP_000787777.1.28257 WP_000787777.1.28274 WP_000787777.1.28315 WP_000787777.1.28319 WP_000787777.1.28347 WP_000787777.1.28400 WP_000787777.1.28430 WP_000787777.1.2852 WP_000787777.1.28578 WP_000787777.1.28580 WP_000787777.1.28605 WP_000787777.1.28652 WP_000787777.1.28720 WP_000787777.1.28763 WP_000787777.1.28784 WP_000787777.1.28785 WP_000787777.1.28848 WP_000787777.1.28871 WP_000787777.1.28909 WP_000787777.1.28981 WP_000787777.1.28987 WP_000787777.1.29052 WP_000787777.1.29060 WP_000787777.1.29112 WP_000787777.1.29155 WP_000787777.1.29166 WP_000787777.1.29187 WP_000787777.1.29226 WP_000787777.1.29242 WP_000787777.1.29263 WP_000787777.1.29276 WP_000787777.1.29329 WP_000787777.1.29366 WP_000787777.1.29368 WP_000787777.1.29395 WP_000787777.1.29420 WP_000787777.1.29468 WP_000787777.1.29522 WP_000787777.1.2957 WP_000787777.1.2972 WP_000787777.1.29736 WP_000787777.1.29744 WP_000787777.1.29788 WP_000787777.1.2981 WP_000787777.1.29862 WP_000787777.1.29902 WP_000787777.1.29905 WP_000787777.1.29918 WP_000787777.1.29981 WP_000787777.1.30051 WP_000787777.1.30089 WP_000787777.1.30095 WP_000787777.1.30100 WP_000787777.1.30152 WP_000787777.1.30197 WP_000787777.1.30204 WP_000787777.1.30209 WP_000787777.1.30249 WP_000787777.1.30268 WP_000787777.1.30302 WP_000787777.1.30307 WP_000787777.1.30328 WP_000787777.1.30364 WP_000787777.1.30508 WP_000787777.1.30531 WP_000787777.1.30560 WP_000787777.1.30622 WP_000787777.1.30645 WP_000787777.1.30646 WP_000787777.1.30666 WP_000787777.1.30702 WP_000787777.1.30720 WP_000787777.1.30726 WP_000787777.1.30763 WP_000787777.1.3077 WP_000787777.1.30845 WP_000787777.1.30847 WP_000787777.1.30854 WP_000787777.1.31005 WP_000787777.1.31039 WP_000787777.1.31048 WP_000787777.1.31091 WP_000787777.1.31176 WP_000787777.1.31206 WP_000787777.1.3123 WP_000787777.1.31315 WP_000787777.1.31337 WP_000787777.1.31339 WP_000787777.1.31355 WP_000787777.1.31437 WP_000787777.1.31442 WP_000787777.1.31468 WP_000787777.1.31479 WP_000787777.1.31529 WP_000787777.1.31539 WP_000787777.1.31642 WP_000787777.1.31647 WP_000787777.1.31653 WP_000787777.1.31686 WP_000787777.1.31753 WP_000787777.1.31827 WP_000787777.1.31828 WP_000787777.1.31842 WP_000787777.1.31892 WP_000787777.1.31931 WP_000787777.1.31997 WP_000787777.1.32003 WP_000787777.1.32005 WP_000787777.1.32029 WP_000787777.1.32067 WP_000787777.1.32160 WP_000787777.1.32207 WP_000787777.1.3229 WP_000787777.1.32339 WP_000787777.1.3242 WP_000787777.1.32474 WP_000787777.1.32481 WP_000787777.1.32483 WP_000787777.1.32514 WP_000787777.1.32534 WP_000787777.1.32565 WP_000787777.1.32607 WP_000787777.1.32634 WP_000787777.1.32645 WP_000787777.1.32746 WP_000787777.1.32764 WP_000787777.1.32770 WP_000787777.1.32800 WP_000787777.1.32928 WP_000787777.1.32939 WP_000787777.1.32954 WP_000787777.1.33038 WP_000787777.1.33048 WP_000787777.1.33110 WP_000787777.1.33123 WP_000787777.1.33138 WP_000787777.1.33250 WP_000787777.1.33266 WP_000787777.1.33296 WP_000787777.1.33335 WP_000787777.1.33357 WP_000787777.1.33416 WP_000787777.1.3342 WP_000787777.1.33432 WP_000787777.1.33468 WP_000787777.1.3347 WP_000787777.1.33507 WP_000787777.1.33594 WP_000787777.1.33626 WP_000787777.1.33627 WP_000787777.1.3363 WP_000787777.1.33654 WP_000787777.1.33692 WP_000787777.1.33695 WP_000787777.1.33718 WP_000787777.1.33735 WP_000787777.1.33743 WP_000787777.1.33769 WP_000787777.1.33792 WP_000787777.1.33804 WP_000787777.1.33813 WP_000787777.1.33968 WP_000787777.1.33971 WP_000787777.1.33983 WP_000787777.1.34026 WP_000787777.1.34030 WP_000787777.1.34051 WP_000787777.1.34062 WP_000787777.1.34100 WP_000787777.1.34132 WP_000787777.1.34182 WP_000787777.1.34209 WP_000787777.1.34244 WP_000787777.1.34250 WP_000787777.1.34251 WP_000787777.1.34285 WP_000787777.1.34381 WP_000787777.1.34403 WP_000787777.1.34410 WP_000787777.1.34482 WP_000787777.1.34492 WP_000787777.1.34502 WP_000787777.1.34510 WP_000787777.1.34526 WP_000787777.1.3461 WP_000787777.1.34677 WP_000787777.1.34737 WP_000787777.1.34767 WP_000787777.1.34818 WP_000787777.1.34890 WP_000787777.1.34918 WP_000787777.1.34998 WP_000787777.1.35059 WP_000787777.1.35062 WP_000787777.1.35089 WP_000787777.1.35097 WP_000787777.1.35110 WP_000787777.1.35121 WP_000787777.1.35233 WP_000787777.1.35276 WP_000787777.1.35285 WP_000787777.1.35297 WP_000787777.1.35334 WP_000787777.1.35342 WP_000787777.1.354 WP_000787777.1.35415 WP_000787777.1.3547 WP_000787777.1.35498 WP_000787777.1.35525 WP_000787777.1.35580 WP_000787777.1.35615 WP_000787777.1.35623 WP_000787777.1.35673 WP_000787777.1.3569 WP_000787777.1.35801 WP_000787777.1.35826 WP_000787777.1.35928 WP_000787777.1.35950 WP_000787777.1.36004 WP_000787777.1.36082 WP_000787777.1.36102 WP_000787777.1.36119 WP_000787777.1.36141 WP_000787777.1.3617 WP_000787777.1.36176 WP_000787777.1.36187 WP_000787777.1.36188 WP_000787777.1.36250 WP_000787777.1.36264 WP_000787777.1.36278 WP_000787777.1.36282 WP_000787777.1.36307 WP_000787777.1.36344 WP_000787777.1.36389 WP_000787777.1.36532 WP_000787777.1.36535 WP_000787777.1.3655 WP_000787777.1.36570 WP_000787777.1.36580 WP_000787777.1.36600 WP_000787777.1.36615 WP_000787777.1.36646 WP_000787777.1.36689 WP_000787777.1.36697 WP_000787777.1.36745 WP_000787777.1.3675 WP_000787777.1.36783 WP_000787777.1.36796 WP_000787777.1.36822 WP_000787777.1.3685 WP_000787777.1.3687 WP_000787777.1.36955 WP_000787777.1.36979 WP_000787777.1.36980 WP_000787777.1.36997 WP_000787777.1.37002 WP_000787777.1.37016 WP_000787777.1.3703 WP_000787777.1.37044 WP_000787777.1.37080 WP_000787777.1.37121 WP_000787777.1.37134 WP_000787777.1.37220 WP_000787777.1.37341 WP_000787777.1.37398 WP_000787777.1.37424 WP_000787777.1.37467 WP_000787777.1.37583 WP_000787777.1.37602 WP_000787777.1.37605 WP_000787777.1.37606 WP_000787777.1.37621 WP_000787777.1.37624 WP_000787777.1.3776 WP_000787777.1.37781 WP_000787777.1.37815 WP_000787777.1.37828 WP_000787777.1.37953 WP_000787777.1.37987 WP_000787777.1.38038 WP_000787777.1.38057 WP_000787777.1.38070 WP_000787777.1.38082 WP_000787777.1.3809 WP_000787777.1.38160 WP_000787777.1.38177 WP_000787777.1.3820 WP_000787777.1.38230 WP_000787777.1.38232 WP_000787777.1.38276 WP_000787777.1.38282 WP_000787777.1.38309 WP_000787777.1.38339 WP_000787777.1.38383 WP_000787777.1.3842 WP_000787777.1.38437 WP_000787777.1.38453 WP_000787777.1.38493 WP_000787777.1.38522 WP_000787777.1.38546 WP_000787777.1.38607 WP_000787777.1.38612 WP_000787777.1.3867 WP_000787777.1.38674 WP_000787777.1.38721 WP_000787777.1.38760 WP_000787777.1.38823 WP_000787777.1.38841 WP_000787777.1.38858 WP_000787777.1.38926 WP_000787777.1.38931 WP_000787777.1.38940 WP_000787777.1.38941 WP_000787777.1.38972 WP_000787777.1.38989 WP_000787777.1.390 WP_000787777.1.39012 WP_000787777.1.39014 WP_000787777.1.39043 WP_000787777.1.3906 WP_000787777.1.391 WP_000787777.1.39108 WP_000787777.1.39203 WP_000787777.1.39206 WP_000787777.1.39217 WP_000787777.1.3926 WP_000787777.1.39272 WP_000787777.1.39290 WP_000787777.1.39332 WP_000787777.1.39333 WP_000787777.1.39397 WP_000787777.1.39406 WP_000787777.1.39486 WP_000787777.1.39506 WP_000787777.1.39550 WP_000787777.1.39645 WP_000787777.1.39687 WP_000787777.1.39689 WP_000787777.1.39697 WP_000787777.1.39711 WP_000787777.1.39738 WP_000787777.1.39767 WP_000787777.1.39789 WP_000787777.1.39832 WP_000787777.1.39838 WP_000787777.1.39856 WP_000787777.1.39869 WP_000787777.1.40014 WP_000787777.1.40043 WP_000787777.1.40099 WP_000787777.1.40120 WP_000787777.1.40137 WP_000787777.1.4015 WP_000787777.1.40164 WP_000787777.1.40173 WP_000787777.1.4019 WP_000787777.1.40318 WP_000787777.1.40320 WP_000787777.1.40330 WP_000787777.1.40342 WP_000787777.1.40368 WP_000787777.1.40406 WP_000787777.1.4045 WP_000787777.1.40474 WP_000787777.1.40481 WP_000787777.1.40505 WP_000787777.1.40531 WP_000787777.1.40532 WP_000787777.1.4056 WP_000787777.1.40579 WP_000787777.1.40588 WP_000787777.1.40620 WP_000787777.1.40644 WP_000787777.1.40655 WP_000787777.1.40658 WP_000787777.1.40659 WP_000787777.1.40760 WP_000787777.1.40797 WP_000787777.1.40816 WP_000787777.1.41064 WP_000787777.1.41084 WP_000787777.1.41094 WP_000787777.1.41119 WP_000787777.1.41129 WP_000787777.1.4115 WP_000787777.1.41178 WP_000787777.1.41208 WP_000787777.1.41241 WP_000787777.1.41255 WP_000787777.1.41289 WP_000787777.1.4129 WP_000787777.1.41426 WP_000787777.1.41432 WP_000787777.1.41433 WP_000787777.1.41499 WP_000787777.1.41558 WP_000787777.1.41567 WP_000787777.1.41582 WP_000787777.1.41674 WP_000787777.1.41839 WP_000787777.1.4188 WP_000787777.1.41898 WP_000787777.1.41935 WP_000787777.1.41943 WP_000787777.1.41989 WP_000787777.1.420 WP_000787777.1.42015 WP_000787777.1.42017 WP_000787777.1.42028 WP_000787777.1.42087 WP_000787777.1.42125 WP_000787777.1.42137 WP_000787777.1.42198 WP_000787777.1.42269 WP_000787777.1.42305 WP_000787777.1.42355 WP_000787777.1.42403 WP_000787777.1.42436 WP_000787777.1.42459 WP_000787777.1.42481 WP_000787777.1.42510 WP_000787777.1.42593 WP_000787777.1.426 WP_000787777.1.42640 WP_000787777.1.42652 WP_000787777.1.42668 WP_000787777.1.42674 WP_000787777.1.42737 WP_000787777.1.42759 WP_000787777.1.42786 WP_000787777.1.42837 WP_000787777.1.4293 WP_000787777.1.4299 WP_000787777.1.43014 WP_000787777.1.43047 WP_000787777.1.43072 WP_000787777.1.43122 WP_000787777.1.43131 WP_000787777.1.43134 WP_000787777.1.43143 WP_000787777.1.43147 WP_000787777.1.43159 WP_000787777.1.43165 WP_000787777.1.43202 WP_000787777.1.43232 WP_000787777.1.43248 WP_000787777.1.4325 WP_000787777.1.43263 WP_000787777.1.4327 WP_000787777.1.43274 WP_000787777.1.43323 WP_000787777.1.43341 WP_000787777.1.43349 WP_000787777.1.43369 WP_000787777.1.4337 WP_000787777.1.43406 WP_000787777.1.4341 WP_000787777.1.43460 WP_000787777.1.4347 WP_000787777.1.43550 WP_000787777.1.43560 WP_000787777.1.43617 WP_000787777.1.43618 WP_000787777.1.43627 WP_000787777.1.43659 WP_000787777.1.43670 WP_000787777.1.43702 WP_000787777.1.43703 WP_000787777.1.4372 WP_000787777.1.43731 WP_000787777.1.43752 WP_000787777.1.43788 WP_000787777.1.43819 WP_000787777.1.43827 WP_000787777.1.4385 WP_000787777.1.43904 WP_000787777.1.43915 WP_000787777.1.44119 WP_000787777.1.44153 WP_000787777.1.44181 WP_000787777.1.44195 WP_000787777.1.44265 WP_000787777.1.44302 WP_000787777.1.44388 WP_000787777.1.44396 WP_000787777.1.44405 WP_000787777.1.44420 WP_000787777.1.44579 WP_000787777.1.44588 WP_000787777.1.44605 WP_000787777.1.44631 WP_000787777.1.44672 WP_000787777.1.44732 WP_000787777.1.44755 WP_000787777.1.44785 WP_000787777.1.44788 WP_000787777.1.44796 WP_000787777.1.44881 WP_000787777.1.44882 WP_000787777.1.44914 WP_000787777.1.44955 WP_000787777.1.45033 WP_000787777.1.45035 WP_000787777.1.45099 WP_000787777.1.4513 WP_000787777.1.45133 WP_000787777.1.45164 WP_000787777.1.45170 WP_000787777.1.45272 WP_000787777.1.45290 WP_000787777.1.45297 WP_000787777.1.453 WP_000787777.1.45364 WP_000787777.1.45431 WP_000787777.1.45439 WP_000787777.1.45472 WP_000787777.1.4550 WP_000787777.1.45507 WP_000787777.1.45560 WP_000787777.1.45577 WP_000787777.1.45670 WP_000787777.1.45703 WP_000787777.1.45730 WP_000787777.1.45734 WP_000787777.1.45768 WP_000787777.1.45771 WP_000787777.1.45780 WP_000787777.1.4584 WP_000787777.1.45852 WP_000787777.1.45897 WP_000787777.1.45954 WP_000787777.1.4598 WP_000787777.1.46003 WP_000787777.1.46005 WP_000787777.1.46055 WP_000787777.1.46087 WP_000787777.1.46168 WP_000787777.1.46208 WP_000787777.1.46222 WP_000787777.1.46228 WP_000787777.1.46276 WP_000787777.1.46330 WP_000787777.1.46334 WP_000787777.1.46362 WP_000787777.1.46368 WP_000787777.1.46380 WP_000787777.1.46401 WP_000787777.1.46422 WP_000787777.1.46465 WP_000787777.1.46543 WP_000787777.1.4662 WP_000787777.1.46660 WP_000787777.1.46664 WP_000787777.1.46670 WP_000787777.1.46692 WP_000787777.1.46702 WP_000787777.1.46752 WP_000787777.1.46765 WP_000787777.1.46852 WP_000787777.1.46881 WP_000787777.1.46908 WP_000787777.1.46925 WP_000787777.1.46937 WP_000787777.1.4696 WP_000787777.1.46983 WP_000787777.1.46995 WP_000787777.1.47051 WP_000787777.1.47128 WP_000787777.1.47153 WP_000787777.1.47159 WP_000787777.1.47163 WP_000787777.1.47187 WP_000787777.1.47211 WP_000787777.1.47216 WP_000787777.1.47258 WP_000787777.1.47269 WP_000787777.1.47279 WP_000787777.1.4728 WP_000787777.1.47290 WP_000787777.1.47294 WP_000787777.1.47306 WP_000787777.1.47328 WP_000787777.1.47381 WP_000787777.1.47399 WP_000787777.1.47406 WP_000787777.1.47426 WP_000787777.1.47432 WP_000787777.1.47439 WP_000787777.1.47560 WP_000787777.1.47618 WP_000787777.1.4767 WP_000787777.1.477 WP_000787777.1.47763 WP_000787777.1.47782 WP_000787777.1.47836 WP_000787777.1.47859 WP_000787777.1.47872 WP_000787777.1.47873 WP_000787777.1.47996 WP_000787777.1.48011 WP_000787777.1.48030 WP_000787777.1.48047 WP_000787777.1.4805 WP_000787777.1.48149 WP_000787777.1.4815 WP_000787777.1.48154 WP_000787777.1.48169 WP_000787777.1.48186 WP_000787777.1.48227 WP_000787777.1.48236 WP_000787777.1.48250 WP_000787777.1.48284 WP_000787777.1.48293 WP_000787777.1.48307 WP_000787777.1.48322 WP_000787777.1.48391 WP_000787777.1.48394 WP_000787777.1.48463 WP_000787777.1.48563 WP_000787777.1.48577 WP_000787777.1.48593 WP_000787777.1.48634 WP_000787777.1.48656 WP_000787777.1.4868 WP_000787777.1.48705 WP_000787777.1.48711 WP_000787777.1.48805 WP_000787777.1.48823 WP_000787777.1.48833 WP_000787777.1.48835 WP_000787777.1.4886 WP_000787777.1.48936 WP_000787777.1.48941 WP_000787777.1.48945 WP_000787777.1.48951 WP_000787777.1.48968 WP_000787777.1.48982 WP_000787777.1.48993 WP_000787777.1.4901 WP_000787777.1.4905 WP_000787777.1.49129 WP_000787777.1.49159 WP_000787777.1.4916 WP_000787777.1.49161 WP_000787777.1.4917 WP_000787777.1.4918 WP_000787777.1.49207 WP_000787777.1.49248 WP_000787777.1.49327 WP_000787777.1.49398 WP_000787777.1.4950 WP_000787777.1.4962 WP_000787777.1.49653 WP_000787777.1.49669 WP_000787777.1.49730 WP_000787777.1.49742 WP_000787777.1.4980 WP_000787777.1.49800 WP_000787777.1.49860 WP_000787777.1.49863 WP_000787777.1.49871 WP_000787777.1.4989 WP_000787777.1.49894 WP_000787777.1.49907 WP_000787777.1.49934 WP_000787777.1.4994 WP_000787777.1.49970 WP_000787777.1.49982 WP_000787777.1.50013 WP_000787777.1.50038 WP_000787777.1.50039 WP_000787777.1.50061 WP_000787777.1.50076 WP_000787777.1.5013 WP_000787777.1.50138 WP_000787777.1.50217 WP_000787777.1.50219 WP_000787777.1.50261 WP_000787777.1.50313 WP_000787777.1.50314 WP_000787777.1.50356 WP_000787777.1.50425 WP_000787777.1.50430 WP_000787777.1.50536 WP_000787777.1.50555 WP_000787777.1.50578 WP_000787777.1.50595 WP_000787777.1.50660 WP_000787777.1.50768 WP_000787777.1.50799 WP_000787777.1.50820 WP_000787777.1.50884 WP_000787777.1.50896 WP_000787777.1.50937 WP_000787777.1.50962 WP_000787777.1.5109 WP_000787777.1.5110 WP_000787777.1.5111 WP_000787777.1.51152 WP_000787777.1.51236 WP_000787777.1.51245 WP_000787777.1.51250 WP_000787777.1.51282 WP_000787777.1.51295 WP_000787777.1.51306 WP_000787777.1.51310 WP_000787777.1.51346 WP_000787777.1.51376 WP_000787777.1.51403 WP_000787777.1.51454 WP_000787777.1.51456 WP_000787777.1.51492 WP_000787777.1.515 WP_000787777.1.51527 WP_000787777.1.5155 WP_000787777.1.51559 WP_000787777.1.51575 WP_000787777.1.51590 WP_000787777.1.51665 WP_000787777.1.51716 WP_000787777.1.51748 WP_000787777.1.51797 WP_000787777.1.51836 WP_000787777.1.51842 WP_000787777.1.51844 WP_000787777.1.51871 WP_000787777.1.51883 WP_000787777.1.51924 WP_000787777.1.51936 WP_000787777.1.51952 WP_000787777.1.51971 WP_000787777.1.51995 WP_000787777.1.52078 WP_000787777.1.521 WP_000787777.1.5213 WP_000787777.1.52151 WP_000787777.1.52182 WP_000787777.1.52185 WP_000787777.1.52193 WP_000787777.1.52251 WP_000787777.1.52296 WP_000787777.1.523 WP_000787777.1.52322 WP_000787777.1.52327 WP_000787777.1.52331 WP_000787777.1.52340 WP_000787777.1.52440 WP_000787777.1.52442 WP_000787777.1.52463 WP_000787777.1.52518 WP_000787777.1.52548 WP_000787777.1.52595 WP_000787777.1.52623 WP_000787777.1.52624 WP_000787777.1.52645 WP_000787777.1.52687 WP_000787777.1.52699 WP_000787777.1.52715 WP_000787777.1.52722 WP_000787777.1.52848 WP_000787777.1.52877 WP_000787777.1.52878 WP_000787777.1.52941 WP_000787777.1.52947 WP_000787777.1.52984 WP_000787777.1.53002 WP_000787777.1.53071 WP_000787777.1.53140 WP_000787777.1.53153 WP_000787777.1.53178 WP_000787777.1.53209 WP_000787777.1.53260 WP_000787777.1.53317 WP_000787777.1.53319 WP_000787777.1.53387 WP_000787777.1.53394 WP_000787777.1.53403 WP_000787777.1.53432 WP_000787777.1.53462 WP_000787777.1.53521 WP_000787777.1.53577 WP_000787777.1.53641 WP_000787777.1.53648 WP_000787777.1.53671 WP_000787777.1.53766 WP_000787777.1.53827 WP_000787777.1.53835 WP_000787777.1.53889 WP_000787777.1.53915 WP_000787777.1.53934 WP_000787777.1.53969 WP_000787777.1.53999 WP_000787777.1.5401 WP_000787777.1.54022 WP_000787777.1.54109 WP_000787777.1.54147 WP_000787777.1.54229 WP_000787777.1.54253 WP_000787777.1.54297 WP_000787777.1.54395 WP_000787777.1.544 WP_000787777.1.54413 WP_000787777.1.54503 WP_000787777.1.54510 WP_000787777.1.54551 WP_000787777.1.54637 WP_000787777.1.54675 WP_000787777.1.5469 WP_000787777.1.54745 WP_000787777.1.54753 WP_000787777.1.54878 WP_000787777.1.54955 WP_000787777.1.55014 WP_000787777.1.5519 WP_000787777.1.55214 WP_000787777.1.55274 WP_000787777.1.55309 WP_000787777.1.55367 WP_000787777.1.55369 WP_000787777.1.55403 WP_000787777.1.55405 WP_000787777.1.55421 WP_000787777.1.55508 WP_000787777.1.5554 WP_000787777.1.55544 WP_000787777.1.55558 WP_000787777.1.5556 WP_000787777.1.55583 WP_000787777.1.5559 WP_000787777.1.55628 WP_000787777.1.55637 WP_000787777.1.55653 WP_000787777.1.557 WP_000787777.1.55728 WP_000787777.1.55786 WP_000787777.1.5580 WP_000787777.1.55818 WP_000787777.1.55831 WP_000787777.1.55835 WP_000787777.1.55867 WP_000787777.1.55886 WP_000787777.1.5589 WP_000787777.1.55904 WP_000787777.1.55916 WP_000787777.1.55933 WP_000787777.1.55953 WP_000787777.1.56000 WP_000787777.1.56025 WP_000787777.1.56048 WP_000787777.1.56078 WP_000787777.1.56098 WP_000787777.1.56225 WP_000787777.1.5623 WP_000787777.1.56239 WP_000787777.1.56281 WP_000787777.1.56332 WP_000787777.1.56333 WP_000787777.1.5635 WP_000787777.1.56400 WP_000787777.1.5644 WP_000787777.1.56558 WP_000787777.1.5658 WP_000787777.1.56598 WP_000787777.1.566 WP_000787777.1.56628 WP_000787777.1.56641 WP_000787777.1.56658 WP_000787777.1.5666 WP_000787777.1.5677 WP_000787777.1.56778 WP_000787777.1.56794 WP_000787777.1.56815 WP_000787777.1.56856 WP_000787777.1.5686 WP_000787777.1.56865 WP_000787777.1.56878 WP_000787777.1.569 WP_000787777.1.56986 WP_000787777.1.57047 WP_000787777.1.57073 WP_000787777.1.57075 WP_000787777.1.57097 WP_000787777.1.57109 WP_000787777.1.57170 WP_000787777.1.5718 WP_000787777.1.57190 WP_000787777.1.57214 WP_000787777.1.57265 WP_000787777.1.57309 WP_000787777.1.57445 WP_000787777.1.57481 WP_000787777.1.57594 WP_000787777.1.57650 WP_000787777.1.57665 WP_000787777.1.57682 WP_000787777.1.57692 WP_000787777.1.57730 WP_000787777.1.57734 WP_000787777.1.57754 WP_000787777.1.57808 WP_000787777.1.57819 WP_000787777.1.57837 WP_000787777.1.57840 WP_000787777.1.57861 WP_000787777.1.57878 WP_000787777.1.5791 WP_000787777.1.57943 WP_000787777.1.57952 WP_000787777.1.57974 WP_000787777.1.58016 WP_000787777.1.58049 WP_000787777.1.58074 WP_000787777.1.58116 WP_000787777.1.58127 WP_000787777.1.58148 WP_000787777.1.58158 WP_000787777.1.5816 WP_000787777.1.58277 WP_000787777.1.58317 WP_000787777.1.58352 WP_000787777.1.58364 WP_000787777.1.58395 WP_000787777.1.58430 WP_000787777.1.58435 WP_000787777.1.58530 WP_000787777.1.5857 WP_000787777.1.58571 WP_000787777.1.58592 WP_000787777.1.58598 WP_000787777.1.58704 WP_000787777.1.58735 WP_000787777.1.58760 WP_000787777.1.58763 WP_000787777.1.58772 WP_000787777.1.5880 WP_000787777.1.58833 WP_000787777.1.58934 WP_000787777.1.58981 WP_000787777.1.59011 WP_000787777.1.59014 WP_000787777.1.59039 WP_000787777.1.59077 WP_000787777.1.59098 WP_000787777.1.59124 WP_000787777.1.59146 WP_000787777.1.5920 WP_000787777.1.59311 WP_000787777.1.59398 WP_000787777.1.5940 WP_000787777.1.59462 WP_000787777.1.59464 WP_000787777.1.59498 WP_000787777.1.59540 WP_000787777.1.59546 WP_000787777.1.59598 WP_000787777.1.59668 WP_000787777.1.59669 WP_000787777.1.59671 WP_000787777.1.5972 WP_000787777.1.59787 WP_000787777.1.5982 WP_000787777.1.59822 WP_000787777.1.59874 WP_000787777.1.59907 WP_000787777.1.59915 WP_000787777.1.60006 WP_000787777.1.6006 WP_000787777.1.6011 WP_000787777.1.60123 WP_000787777.1.60147 WP_000787777.1.60149 WP_000787777.1.60157 WP_000787777.1.6017 WP_000787777.1.60227 WP_000787777.1.60302 WP_000787777.1.60345 WP_000787777.1.60353 WP_000787777.1.60360 WP_000787777.1.60434 WP_000787777.1.60492 WP_000787777.1.60547 WP_000787777.1.60585 WP_000787777.1.60595 WP_000787777.1.60636 WP_000787777.1.60641 WP_000787777.1.60734 WP_000787777.1.60750 WP_000787777.1.60751 WP_000787777.1.60758 WP_000787777.1.60759 WP_000787777.1.60765 WP_000787777.1.60778 WP_000787777.1.60813 WP_000787777.1.60820 WP_000787777.1.60845 WP_000787777.1.6085 WP_000787777.1.60869 WP_000787777.1.60888 WP_000787777.1.60912 WP_000787777.1.60923 WP_000787777.1.60948 WP_000787777.1.60965 WP_000787777.1.60991 WP_000787777.1.61013 WP_000787777.1.61023 WP_000787777.1.61026 WP_000787777.1.61029 WP_000787777.1.61031 WP_000787777.1.61082 WP_000787777.1.61115 WP_000787777.1.61139 WP_000787777.1.61189 WP_000787777.1.6119 WP_000787777.1.6123 WP_000787777.1.61263 WP_000787777.1.61271 WP_000787777.1.61286 WP_000787777.1.61289 WP_000787777.1.61313 WP_000787777.1.61316 WP_000787777.1.6136 WP_000787777.1.61375 WP_000787777.1.61430 WP_000787777.1.61439 WP_000787777.1.61440 WP_000787777.1.61555 WP_000787777.1.61585 WP_000787777.1.61597 WP_000787777.1.61615 WP_000787777.1.61639 WP_000787777.1.6166 WP_000787777.1.61705 WP_000787777.1.61749 WP_000787777.1.61800 WP_000787777.1.61802 WP_000787777.1.61838 WP_000787777.1.61903 WP_000787777.1.61936 WP_000787777.1.61978 WP_000787777.1.62002 WP_000787777.1.6201 WP_000787777.1.62028 WP_000787777.1.62069 WP_000787777.1.62071 WP_000787777.1.62096 WP_000787777.1.62247 WP_000787777.1.62254 WP_000787777.1.62346 WP_000787777.1.62352 WP_000787777.1.62382 WP_000787777.1.62398 WP_000787777.1.62429 WP_000787777.1.62453 WP_000787777.1.62474 WP_000787777.1.62496 WP_000787777.1.6250 WP_000787777.1.62553 WP_000787777.1.62602 WP_000787777.1.62653 WP_000787777.1.62671 WP_000787777.1.62674 WP_000787777.1.6268 WP_000787777.1.62684 WP_000787777.1.62723 WP_000787777.1.62764 WP_000787777.1.62771 WP_000787777.1.62822 WP_000787777.1.62824 WP_000787777.1.62831 WP_000787777.1.62863 WP_000787777.1.62880 WP_000787777.1.62970 WP_000787777.1.63003 WP_000787777.1.63027 WP_000787777.1.63052 WP_000787777.1.63070 WP_000787777.1.63083 WP_000787777.1.63139 WP_000787777.1.63140 WP_000787777.1.63220 WP_000787777.1.63266 WP_000787777.1.63289 WP_000787777.1.63304 WP_000787777.1.63313 WP_000787777.1.63333 WP_000787777.1.63341 WP_000787777.1.63441 WP_000787777.1.63469 WP_000787777.1.63471 WP_000787777.1.63589 WP_000787777.1.63673 WP_000787777.1.63678 WP_000787777.1.63726 WP_000787777.1.63729 WP_000787777.1.63751 WP_000787777.1.63759 WP_000787777.1.63774 WP_000787777.1.63828 WP_000787777.1.6388 WP_000787777.1.63907 WP_000787777.1.6403 WP_000787777.1.6408 WP_000787777.1.64192 WP_000787777.1.64250 WP_000787777.1.64367 WP_000787777.1.6438 WP_000787777.1.64456 WP_000787777.1.64457 WP_000787777.1.64525 WP_000787777.1.64565 WP_000787777.1.64583 WP_000787777.1.6459 WP_000787777.1.6462 WP_000787777.1.64677 WP_000787777.1.64686 WP_000787777.1.64720 WP_000787777.1.64765 WP_000787777.1.6479 WP_000787777.1.64858 WP_000787777.1.64879 WP_000787777.1.6488 WP_000787777.1.64893 WP_000787777.1.64897 WP_000787777.1.64928 WP_000787777.1.64935 WP_000787777.1.64961 WP_000787777.1.65044 WP_000787777.1.65132 WP_000787777.1.65158 WP_000787777.1.65180 WP_000787777.1.65193 WP_000787777.1.65217 WP_000787777.1.65243 WP_000787777.1.65317 WP_000787777.1.65367 WP_000787777.1.65419 WP_000787777.1.65423 WP_000787777.1.65432 WP_000787777.1.65443 WP_000787777.1.65451 WP_000787777.1.6547 WP_000787777.1.65504 WP_000787777.1.6551 WP_000787777.1.65520 WP_000787777.1.65544 WP_000787777.1.65562 WP_000787777.1.65675 WP_000787777.1.65689 WP_000787777.1.65693 WP_000787777.1.65700 WP_000787777.1.65703 WP_000787777.1.65705 WP_000787777.1.65856 WP_000787777.1.65922 WP_000787777.1.65931 WP_000787777.1.66009 WP_000787777.1.66081 WP_000787777.1.661 WP_000787777.1.66120 WP_000787777.1.66133 WP_000787777.1.66175 WP_000787777.1.66262 WP_000787777.1.66302 WP_000787777.1.66433 WP_000787777.1.66505 WP_000787777.1.66519 WP_000787777.1.66542 WP_000787777.1.66564 WP_000787777.1.66588 WP_000787777.1.66601 WP_000787777.1.66606 WP_000787777.1.66664 WP_000787777.1.66677 WP_000787777.1.66711 WP_000787777.1.6674 WP_000787777.1.66786 WP_000787777.1.66818 WP_000787777.1.6684 WP_000787777.1.67112 WP_000787777.1.67135 WP_000787777.1.67191 WP_000787777.1.6722 WP_000787777.1.67266 WP_000787777.1.67329 WP_000787777.1.67333 WP_000787777.1.67379 WP_000787777.1.6740 WP_000787777.1.67414 WP_000787777.1.67463 WP_000787777.1.67480 WP_000787777.1.67505 WP_000787777.1.67507 WP_000787777.1.67520 WP_000787777.1.67521 WP_000787777.1.67554 WP_000787777.1.67572 WP_000787777.1.67632 WP_000787777.1.67651 WP_000787777.1.67652 WP_000787777.1.67713 WP_000787777.1.67722 WP_000787777.1.67754 WP_000787777.1.67815 WP_000787777.1.6786 WP_000787777.1.67865 WP_000787777.1.67925 WP_000787777.1.67986 WP_000787777.1.68033 WP_000787777.1.68054 WP_000787777.1.68066 WP_000787777.1.6811 WP_000787777.1.68111 WP_000787777.1.68160 WP_000787777.1.68161 WP_000787777.1.68199 WP_000787777.1.68261 WP_000787777.1.68295 WP_000787777.1.6830 WP_000787777.1.6834 WP_000787777.1.68343 WP_000787777.1.68351 WP_000787777.1.68367 WP_000787777.1.6839 WP_000787777.1.68397 WP_000787777.1.68404 WP_000787777.1.68425 WP_000787777.1.68483 WP_000787777.1.68489 WP_000787777.1.68522 WP_000787777.1.68565 WP_000787777.1.68650 WP_000787777.1.68699 WP_000787777.1.68703 WP_000787777.1.68728 WP_000787777.1.68737 WP_000787777.1.68775 WP_000787777.1.68813 WP_000787777.1.68831 WP_000787777.1.68854 WP_000787777.1.68944 WP_000787777.1.69045 WP_000787777.1.69087 WP_000787777.1.69089 WP_000787777.1.6917 WP_000787777.1.69191 WP_000787777.1.69219 WP_000787777.1.69222 WP_000787777.1.69237 WP_000787777.1.69366 WP_000787777.1.69395 WP_000787777.1.69415 WP_000787777.1.69476 WP_000787777.1.69480 WP_000787777.1.695 WP_000787777.1.69552 WP_000787777.1.69563 WP_000787777.1.69622 WP_000787777.1.69679 WP_000787777.1.69877 WP_000787777.1.69878 WP_000787777.1.69921 WP_000787777.1.69987 WP_000787777.1.70024 WP_000787777.1.70048 WP_000787777.1.70105 WP_000787777.1.7012 WP_000787777.1.70133 WP_000787777.1.7024 WP_000787777.1.70253 WP_000787777.1.70273 WP_000787777.1.7034 WP_000787777.1.70344 WP_000787777.1.70349 WP_000787777.1.7043 WP_000787777.1.70459 WP_000787777.1.70462 WP_000787777.1.7053 WP_000787777.1.70546 WP_000787777.1.7061 WP_000787777.1.70635 WP_000787777.1.70641 WP_000787777.1.7067 WP_000787777.1.7073 WP_000787777.1.70818 WP_000787777.1.70823 WP_000787777.1.70855 WP_000787777.1.70924 WP_000787777.1.70930 WP_000787777.1.70943 WP_000787777.1.71043 WP_000787777.1.71058 WP_000787777.1.71059 WP_000787777.1.71073 WP_000787777.1.7109 WP_000787777.1.71130 WP_000787777.1.71196 WP_000787777.1.7120 WP_000787777.1.7125 WP_000787777.1.71257 WP_000787777.1.71295 WP_000787777.1.71298 WP_000787777.1.71345 WP_000787777.1.71359 WP_000787777.1.71463 WP_000787777.1.7150 WP_000787777.1.71519 WP_000787777.1.71529 WP_000787777.1.71596 WP_000787777.1.71602 WP_000787777.1.7161 WP_000787777.1.71662 WP_000787777.1.71676 WP_000787777.1.71735 WP_000787777.1.7179 WP_000787777.1.71861 WP_000787777.1.71925 WP_000787777.1.71989 WP_000787777.1.72026 WP_000787777.1.72031 WP_000787777.1.72067 WP_000787777.1.72169 WP_000787777.1.72205 WP_000787777.1.72271 WP_000787777.1.72330 WP_000787777.1.72347 WP_000787777.1.7236 WP_000787777.1.72366 WP_000787777.1.72424 WP_000787777.1.72547 WP_000787777.1.72654 WP_000787777.1.72787 WP_000787777.1.72832 WP_000787777.1.72834 WP_000787777.1.72835 WP_000787777.1.72903 WP_000787777.1.72904 WP_000787777.1.72935 WP_000787777.1.72945 WP_000787777.1.73017 WP_000787777.1.73019 WP_000787777.1.73022 WP_000787777.1.73037 WP_000787777.1.73122 WP_000787777.1.73132 WP_000787777.1.73246 WP_000787777.1.73265 WP_000787777.1.73286 WP_000787777.1.73386 WP_000787777.1.73456 WP_000787777.1.73501 WP_000787777.1.73571 WP_000787777.1.73591 WP_000787777.1.736 WP_000787777.1.73639 WP_000787777.1.73685 WP_000787777.1.73735 WP_000787777.1.73786 WP_000787777.1.7380 WP_000787777.1.73834 WP_000787777.1.73858 WP_000787777.1.73910 WP_000787777.1.73920 WP_000787777.1.73961 WP_000787777.1.73969 WP_000787777.1.73976 WP_000787777.1.73983 WP_000787777.1.74006 WP_000787777.1.74010 WP_000787777.1.74027 WP_000787777.1.74081 WP_000787777.1.74157 WP_000787777.1.74161 WP_000787777.1.74173 WP_000787777.1.74183 WP_000787777.1.74216 WP_000787777.1.74234 WP_000787777.1.74237 WP_000787777.1.7427 WP_000787777.1.7434 WP_000787777.1.74353 WP_000787777.1.74356 WP_000787777.1.74380 WP_000787777.1.74429 WP_000787777.1.74457 WP_000787777.1.7457 WP_000787777.1.74587 WP_000787777.1.74610 WP_000787777.1.74638 WP_000787777.1.74696 WP_000787777.1.74704 WP_000787777.1.74731 WP_000787777.1.74747 WP_000787777.1.74802 WP_000787777.1.74866 WP_000787777.1.74890 WP_000787777.1.74911 WP_000787777.1.74922 WP_000787777.1.74961 WP_000787777.1.74994 WP_000787777.1.74999 WP_000787777.1.75038 WP_000787777.1.75044 WP_000787777.1.75052 WP_000787777.1.75186 WP_000787777.1.75227 WP_000787777.1.75252 WP_000787777.1.75253 WP_000787777.1.75294 WP_000787777.1.75298 WP_000787777.1.75320 WP_000787777.1.75327 WP_000787777.1.75349 WP_000787777.1.75365 WP_000787777.1.75399 WP_000787777.1.7542 WP_000787777.1.75438 WP_000787777.1.75440 WP_000787777.1.75527 WP_000787777.1.75551 WP_000787777.1.7561 WP_000787777.1.75649 WP_000787777.1.75652 WP_000787777.1.75685 WP_000787777.1.75769 WP_000787777.1.75775 WP_000787777.1.758 WP_000787777.1.75830 WP_000787777.1.75881 WP_000787777.1.75885 WP_000787777.1.75929 WP_000787777.1.75952 WP_000787777.1.7596 WP_000787777.1.75969 WP_000787777.1.76010 WP_000787777.1.76015 WP_000787777.1.76095 WP_000787777.1.76143 WP_000787777.1.76230 WP_000787777.1.76234 WP_000787777.1.7624 WP_000787777.1.7625 WP_000787777.1.76258 WP_000787777.1.76261 WP_000787777.1.76332 WP_000787777.1.76337 WP_000787777.1.76351 WP_000787777.1.76419 WP_000787777.1.76420 WP_000787777.1.76421 WP_000787777.1.76606 WP_000787777.1.76624 WP_000787777.1.76648 WP_000787777.1.76686 WP_000787777.1.76690 WP_000787777.1.76693 WP_000787777.1.7675 WP_000787777.1.76790 WP_000787777.1.76792 WP_000787777.1.768 WP_000787777.1.76816 WP_000787777.1.76839 WP_000787777.1.76845 WP_000787777.1.76897 WP_000787777.1.76921 WP_000787777.1.76944 WP_000787777.1.76952 WP_000787777.1.76998 WP_000787777.1.77031 WP_000787777.1.77041 WP_000787777.1.77050 WP_000787777.1.77060 WP_000787777.1.77062 WP_000787777.1.77112 WP_000787777.1.77145 WP_000787777.1.77305 WP_000787777.1.7745 WP_000787777.1.7746 WP_000787777.1.77489 WP_000787777.1.77497 WP_000787777.1.77520 WP_000787777.1.77527 WP_000787777.1.77533 WP_000787777.1.77536 WP_000787777.1.77572 WP_000787777.1.77603 WP_000787777.1.77606 WP_000787777.1.77738 WP_000787777.1.7774 WP_000787777.1.77743 WP_000787777.1.77818 WP_000787777.1.77822 WP_000787777.1.77848 WP_000787777.1.77858 WP_000787777.1.7787 WP_000787777.1.77957 WP_000787777.1.78054 WP_000787777.1.78091 WP_000787777.1.78173 WP_000787777.1.78189 WP_000787777.1.78207 WP_000787777.1.78252 WP_000787777.1.78254 WP_000787777.1.78257 WP_000787777.1.7827 WP_000787777.1.78311 WP_000787777.1.78332 WP_000787777.1.78365 WP_000787777.1.78404 WP_000787777.1.7850 WP_000787777.1.78558 WP_000787777.1.7857 WP_000787777.1.78604 WP_000787777.1.78653 WP_000787777.1.78667 WP_000787777.1.78728 WP_000787777.1.78803 WP_000787777.1.78819 WP_000787777.1.78841 WP_000787777.1.78897 WP_000787777.1.78946 WP_000787777.1.78983 WP_000787777.1.7900 WP_000787777.1.79006 WP_000787777.1.79038 WP_000787777.1.79051 WP_000787777.1.79085 WP_000787777.1.79131 WP_000787777.1.79170 WP_000787777.1.79197 WP_000787777.1.79208 WP_000787777.1.79223 WP_000787777.1.7931 WP_000787777.1.79310 WP_000787777.1.79314 WP_000787777.1.79322 WP_000787777.1.79332 WP_000787777.1.79367 WP_000787777.1.79374 WP_000787777.1.79436 WP_000787777.1.79461 WP_000787777.1.79476 WP_000787777.1.79487 WP_000787777.1.79539 WP_000787777.1.79626 WP_000787777.1.79662 WP_000787777.1.79672 WP_000787777.1.79706 WP_000787777.1.79822 WP_000787777.1.79831 WP_000787777.1.79834 WP_000787777.1.79837 WP_000787777.1.7989 WP_000787777.1.79896 WP_000787777.1.79911 WP_000787777.1.7992 WP_000787777.1.79941 WP_000787777.1.79961 WP_000787777.1.79971 WP_000787777.1.79991 WP_000787777.1.80000 WP_000787777.1.80032 WP_000787777.1.80042 WP_000787777.1.80079 WP_000787777.1.80109 WP_000787777.1.80127 WP_000787777.1.80203 WP_000787777.1.80287 WP_000787777.1.80290 WP_000787777.1.8031 WP_000787777.1.8035 WP_000787777.1.80358 WP_000787777.1.80378 WP_000787777.1.8043 WP_000787777.1.80472 WP_000787777.1.80530 WP_000787777.1.8065 WP_000787777.1.80687 WP_000787777.1.80717 WP_000787777.1.80761 WP_000787777.1.80763 WP_000787777.1.80781 WP_000787777.1.80786 WP_000787777.1.80833 WP_000787777.1.8084 WP_000787777.1.80872 WP_000787777.1.80962 WP_000787777.1.81085 WP_000787777.1.81114 WP_000787777.1.81157 WP_000787777.1.81171 WP_000787777.1.81234 WP_000787777.1.8125 WP_000787777.1.8135 WP_000787777.1.81385 WP_000787777.1.81389 WP_000787777.1.8142 WP_000787777.1.8144 WP_000787777.1.81464 WP_000787777.1.81467 WP_000787777.1.81599 WP_000787777.1.81610 WP_000787777.1.81740 WP_000787777.1.81758 WP_000787777.1.81800 WP_000787777.1.81812 WP_000787777.1.81861 WP_000787777.1.81870 WP_000787777.1.81897 WP_000787777.1.81903 WP_000787777.1.81905 WP_000787777.1.81906 WP_000787777.1.81919 WP_000787777.1.81944 WP_000787777.1.81999 WP_000787777.1.82009 WP_000787777.1.82053 WP_000787777.1.8212 WP_000787777.1.82121 WP_000787777.1.82219 WP_000787777.1.82247 WP_000787777.1.82259 WP_000787777.1.82340 WP_000787777.1.82354 WP_000787777.1.82358 WP_000787777.1.82368 WP_000787777.1.82447 WP_000787777.1.8246 WP_000787777.1.82467 WP_000787777.1.82548 WP_000787777.1.82612 WP_000787777.1.8265 WP_000787777.1.82709 WP_000787777.1.82724 WP_000787777.1.82796 WP_000787777.1.8280 WP_000787777.1.82802 WP_000787777.1.82829 WP_000787777.1.82862 WP_000787777.1.8289 WP_000787777.1.82976 WP_000787777.1.82980 WP_000787777.1.83152 WP_000787777.1.83153 WP_000787777.1.83185 WP_000787777.1.83193 WP_000787777.1.83234 WP_000787777.1.83316 WP_000787777.1.83352 WP_000787777.1.83372 WP_000787777.1.83418 WP_000787777.1.83476 WP_000787777.1.83484 WP_000787777.1.83517 WP_000787777.1.83593 WP_000787777.1.83646 WP_000787777.1.83653 WP_000787777.1.83676 WP_000787777.1.83720 WP_000787777.1.83763 WP_000787777.1.83775 WP_000787777.1.83804 WP_000787777.1.83825 WP_000787777.1.8383 WP_000787777.1.83864 WP_000787777.1.83865 WP_000787777.1.83881 WP_000787777.1.83919 WP_000787777.1.83928 WP_000787777.1.83955 WP_000787777.1.83984 WP_000787777.1.84049 WP_000787777.1.84064 WP_000787777.1.84144 WP_000787777.1.84163 WP_000787777.1.84293 WP_000787777.1.84342 WP_000787777.1.84442 WP_000787777.1.84445 WP_000787777.1.84451 WP_000787777.1.84509 WP_000787777.1.84563 WP_000787777.1.84578 WP_000787777.1.84625 WP_000787777.1.84638 WP_000787777.1.8468 WP_000787777.1.84682 WP_000787777.1.8475 WP_000787777.1.84752 WP_000787777.1.84757 WP_000787777.1.84761 WP_000787777.1.84815 WP_000787777.1.84889 WP_000787777.1.84903 WP_000787777.1.84907 WP_000787777.1.84922 WP_000787777.1.8493 WP_000787777.1.85022 WP_000787777.1.85047 WP_000787777.1.85056 WP_000787777.1.85081 WP_000787777.1.85099 WP_000787777.1.85135 WP_000787777.1.85144 WP_000787777.1.85151 WP_000787777.1.85226 WP_000787777.1.85235 WP_000787777.1.85238 WP_000787777.1.85351 WP_000787777.1.85383 WP_000787777.1.85395 WP_000787777.1.85404 WP_000787777.1.85445 WP_000787777.1.85462 WP_000787777.1.85471 WP_000787777.1.85474 WP_000787777.1.85492 WP_000787777.1.85506 WP_000787777.1.85515 WP_000787777.1.85519 WP_000787777.1.85547 WP_000787777.1.85586 WP_000787777.1.85649 WP_000787777.1.85758 WP_000787777.1.85795 WP_000787777.1.85796 WP_000787777.1.85816 WP_000787777.1.85834 WP_000787777.1.85927 WP_000787777.1.85950 WP_000787777.1.85993 WP_000787777.1.86018 WP_000787777.1.86072 WP_000787777.1.86123 WP_000787777.1.86144 WP_000787777.1.86154 WP_000787777.1.86158 WP_000787777.1.86188 WP_000787777.1.86207 WP_000787777.1.8627 WP_000787777.1.86270 WP_000787777.1.86304 WP_000787777.1.86344 WP_000787777.1.86367 WP_000787777.1.86378 WP_000787777.1.8643 WP_000787777.1.86439 WP_000787777.1.86482 WP_000787777.1.86523 WP_000787777.1.86542 WP_000787777.1.86628 WP_000787777.1.86706 WP_000787777.1.86792 WP_000787777.1.8681 WP_000787777.1.86838 WP_000787777.1.86911 WP_000787777.1.86940 WP_000787777.1.86961 WP_000787777.1.86977 WP_000787777.1.87021 WP_000787777.1.87042 WP_000787777.1.87057 WP_000787777.1.87072 WP_000787777.1.87090 WP_000787777.1.87119 WP_000787777.1.87122 WP_000787777.1.87141 WP_000787777.1.87175 WP_000787777.1.87194 WP_000787777.1.8720 WP_000787777.1.87260 WP_000787777.1.87261 WP_000787777.1.87285 WP_000787777.1.87290 WP_000787777.1.8731 WP_000787777.1.87396 WP_000787777.1.87457 WP_000787777.1.87461 WP_000787777.1.87466 WP_000787777.1.875 WP_000787777.1.87508 WP_000787777.1.87515 WP_000787777.1.8753 WP_000787777.1.87543 WP_000787777.1.87710 WP_000787777.1.87718 WP_000787777.1.87748 WP_000787777.1.87764 WP_000787777.1.8779 WP_000787777.1.87808 WP_000787777.1.87828 WP_000787777.1.87879 WP_000787777.1.87912 WP_000787777.1.87963 WP_000787777.1.87972 WP_000787777.1.87995 WP_000787777.1.88013 WP_000787777.1.88032 WP_000787777.1.88061 WP_000787777.1.88114 WP_000787777.1.88150 WP_000787777.1.88270 WP_000787777.1.88317 WP_000787777.1.88319 WP_000787777.1.88351 WP_000787777.1.88367 WP_000787777.1.88371 WP_000787777.1.88380 WP_000787777.1.88480 WP_000787777.1.88498 WP_000787777.1.88518 WP_000787777.1.88558 WP_000787777.1.8857 WP_000787777.1.88580 WP_000787777.1.88599 WP_000787777.1.88623 WP_000787777.1.88636 WP_000787777.1.88642 WP_000787777.1.88671 WP_000787777.1.88694 WP_000787777.1.8872 WP_000787777.1.88739 WP_000787777.1.88856 WP_000787777.1.88859 WP_000787777.1.8888 WP_000787777.1.88922 WP_000787777.1.88934 WP_000787777.1.8900 WP_000787777.1.89086 WP_000787777.1.8913 WP_000787777.1.89133 WP_000787777.1.89181 WP_000787777.1.89194 WP_000787777.1.89195 WP_000787777.1.89204 WP_000787777.1.8924 WP_000787777.1.89258 WP_000787777.1.89284 WP_000787777.1.89516 WP_000787777.1.89537 WP_000787777.1.89544 WP_000787777.1.89545 WP_000787777.1.89559 WP_000787777.1.89655 WP_000787777.1.89672 WP_000787777.1.89678 WP_000787777.1.89726 WP_000787777.1.89730 WP_000787777.1.89754 WP_000787777.1.89883 WP_000787777.1.89935 WP_000787777.1.89960 WP_000787777.1.90005 WP_000787777.1.90018 WP_000787777.1.90038 WP_000787777.1.90046 WP_000787777.1.90055 WP_000787777.1.90091 WP_000787777.1.90131 WP_000787777.1.90148 WP_000787777.1.90161 WP_000787777.1.90180 WP_000787777.1.90215 WP_000787777.1.9022 WP_000787777.1.90243 WP_000787777.1.90253 WP_000787777.1.90276 WP_000787777.1.9030 WP_000787777.1.90331 WP_000787777.1.90367 WP_000787777.1.90473 WP_000787777.1.90544 WP_000787777.1.90554 WP_000787777.1.90604 WP_000787777.1.90647 WP_000787777.1.90660 WP_000787777.1.90683 WP_000787777.1.90726 WP_000787777.1.90728 WP_000787777.1.90738 WP_000787777.1.90745 WP_000787777.1.90801 WP_000787777.1.90804 WP_000787777.1.90861 WP_000787777.1.90896 WP_000787777.1.90903 WP_000787777.1.9100 WP_000787777.1.91011 WP_000787777.1.91054 WP_000787777.1.91126 WP_000787777.1.9114 WP_000787777.1.91158 WP_000787777.1.912 WP_000787777.1.91233 WP_000787777.1.91246 WP_000787777.1.91258 WP_000787777.1.91279 WP_000787777.1.91300 WP_000787777.1.91332 WP_000787777.1.91346 WP_000787777.1.91357 WP_000787777.1.91364 WP_000787777.1.91382 WP_000787777.1.9140 WP_000787777.1.91420 WP_000787777.1.91427 WP_000787777.1.91487 WP_000787777.1.91500 WP_000787777.1.91559 WP_000787777.1.91573 WP_000787777.1.91581 WP_000787777.1.91587 WP_000787777.1.91639 WP_000787777.1.91749 WP_000787777.1.91771 WP_000787777.1.91791 WP_000787777.1.91800 WP_000787777.1.91816 WP_000787777.1.91829 WP_000787777.1.91895 WP_000787777.1.91928 WP_000787777.1.91950 WP_000787777.1.92 WP_000787777.1.92133 WP_000787777.1.92164 WP_000787777.1.92169 WP_000787777.1.92173 WP_000787777.1.92185 WP_000787777.1.92196 WP_000787777.1.92227 WP_000787777.1.9224 WP_000787777.1.92253 WP_000787777.1.9234 WP_000787777.1.9239 WP_000787777.1.92436 WP_000787777.1.92442 WP_000787777.1.92497 WP_000787777.1.92500 WP_000787777.1.92520 WP_000787777.1.92534 WP_000787777.1.92565 WP_000787777.1.92607 WP_000787777.1.92679 WP_000787777.1.92691 WP_000787777.1.92723 WP_000787777.1.92735 WP_000787777.1.92741 WP_000787777.1.92773 WP_000787777.1.92789 WP_000787777.1.92805 WP_000787777.1.92862 WP_000787777.1.92864 WP_000787777.1.9293 WP_000787777.1.92950 WP_000787777.1.93074 WP_000787777.1.93125 WP_000787777.1.93163 WP_000787777.1.93176 WP_000787777.1.93191 WP_000787777.1.93224 WP_000787777.1.93300 WP_000787777.1.93336 WP_000787777.1.93416 WP_000787777.1.93438 WP_000787777.1.93444 WP_000787777.1.93514 WP_000787777.1.9352 WP_000787777.1.9354 WP_000787777.1.9358 WP_000787777.1.93590 WP_000787777.1.93658 WP_000787777.1.93678 WP_000787777.1.93710 WP_000787777.1.93722 WP_000787777.1.93738 WP_000787777.1.93769 WP_000787777.1.93787 WP_000787777.1.9387 WP_000787777.1.93882 WP_000787777.1.93883 WP_000787777.1.93891 WP_000787777.1.93976 WP_000787777.1.9398 WP_000787777.1.94074 WP_000787777.1.94082 WP_000787777.1.94087 WP_000787777.1.94096 WP_000787777.1.94119 WP_000787777.1.94165 WP_000787777.1.94293 WP_000787777.1.94294 WP_000787777.1.94335 WP_000787777.1.94340 WP_000787777.1.9437 WP_000787777.1.94374 WP_000787777.1.94375 WP_000787777.1.94376 WP_000787777.1.94389 WP_000787777.1.94530 WP_000787777.1.94550 WP_000787777.1.94576 WP_000787777.1.94688 WP_000787777.1.94733 WP_000787777.1.94741 WP_000787777.1.94789 WP_000787777.1.94797 WP_000787777.1.94844 WP_000787777.1.94845 WP_000787777.1.9485 WP_000787777.1.94857 WP_000787777.1.94866 WP_000787777.1.9497 WP_000787777.1.94980 WP_000787777.1.94989 WP_000787777.1.94999 WP_000787777.1.95038 WP_000787777.1.95077 WP_000787777.1.9510 WP_000787777.1.95120 WP_000787777.1.95327 WP_000787777.1.95342 WP_000787777.1.95361 WP_000787777.1.95372 WP_000787777.1.9538 WP_000787777.1.95537 WP_000787777.1.95581 WP_000787777.1.95603 WP_000787777.1.95639 WP_000787777.1.95681 WP_000787777.1.95699 WP_000787777.1.95704 WP_000787777.1.95713 WP_000787777.1.95714 WP_000787777.1.95737 WP_000787777.1.95760 WP_000787777.1.95806 WP_000787777.1.95877 WP_000787777.1.95885 WP_000787777.1.95914 WP_000787777.1.95918 WP_000787777.1.95986 WP_000787777.1.95997 WP_000787777.1.96014 WP_000787777.1.96030 WP_000787777.1.96056 WP_000787777.1.96057 WP_000787777.1.96067 WP_000787777.1.96075 WP_000787777.1.96148 WP_000787777.1.96228 WP_000787777.1.96255 WP_000787777.1.96283 WP_000787777.1.96297 WP_000787777.1.96312 WP_000787777.1.96314 WP_000787777.1.96322 WP_000787777.1.96334 WP_000787777.1.96362 WP_000787777.1.96433 WP_000787777.1.96472 WP_000787777.1.9650 WP_000787777.1.96535 WP_000787777.1.96538 WP_000787777.1.96554 WP_000787777.1.96566 WP_000787777.1.96591 WP_000787777.1.96603 WP_000787777.1.96678 WP_000787777.1.96699 WP_000787777.1.96705 WP_000787777.1.9675 WP_000787777.1.96780 WP_000787777.1.96836 WP_000787777.1.96855 WP_000787777.1.96859 WP_000787777.1.96922 WP_000787777.1.96969 WP_000787777.1.96985 WP_000787777.1.96997 WP_000787777.1.97000 WP_000787777.1.97014 WP_000787777.1.97029 WP_000787777.1.97034 WP_000787777.1.97141 WP_000787777.1.97161 WP_000787777.1.97164 WP_000787777.1.97205 WP_000787777.1.97228 WP_000787777.1.97241 WP_000787777.1.97312 WP_000787777.1.97336 WP_000787777.1.97348 WP_000787777.1.97355 WP_000787777.1.97367 WP_000787777.1.9737 WP_000787777.1.97392 WP_000787777.1.97427 WP_000787777.1.97450 WP_000787777.1.97456 WP_000787777.1.97494 WP_000787777.1.97530 WP_000787777.1.97531 WP_000787777.1.97537 WP_000787777.1.97576 WP_000787777.1.97585 WP_000787777.1.97664 WP_000787777.1.97687 WP_000787777.1.97696 WP_000787777.1.97699 WP_000787777.1.97744 WP_000787777.1.97746 WP_000787777.1.97762 WP_000787777.1.9788 WP_000787777.1.97935 WP_000787777.1.97955 WP_000787777.1.97974 WP_000787777.1.97997 WP_000787777.1.98054 WP_000787777.1.98058 WP_000787777.1.98073 WP_000787777.1.98161 WP_000787777.1.98174 WP_000787777.1.98179 WP_000787777.1.98195 WP_000787777.1.98233 WP_000787777.1.98248 WP_000787777.1.98249 WP_000787777.1.98281 WP_000787777.1.98295 WP_000787777.1.98328 WP_000787777.1.98352 WP_000787777.1.98353 WP_000787777.1.98366 WP_000787777.1.98387 WP_000787777.1.98409 WP_000787777.1.98425 WP_000787777.1.98585 WP_000787777.1.98609 WP_000787777.1.98659 WP_000787777.1.98667 WP_000787777.1.9872 WP_000787777.1.98723 WP_000787777.1.98730 WP_000787777.1.98734 WP_000787777.1.98741 WP_000787777.1.98750 WP_000787777.1.98786 WP_000787777.1.98797 WP_000787777.1.98821 WP_000787777.1.98842 WP_000787777.1.98880 WP_000787777.1.98883 WP_000787777.1.98894 WP_000787777.1.98978 WP_000787777.1.98985 WP_000787777.1.9910 WP_000787777.1.99136 WP_000787777.1.99207 WP_000787777.1.99283 WP_000787777.1.99308 WP_000787777.1.99414 WP_000787777.1.99418 WP_000787777.1.99509 WP_000787777.1.99523 WP_000787777.1.9965 WP_000787777.1.99830 WP_000787777.1.99849 WP_000787777.1.99859 WP_000787777.1.99884 WP_000787777.1.99954 WP_000787777.1.99955 WP_000787777.1.99984 WP_000787777.1.99999 gi|387149329|ref|YP_005740893.1| gi|150392608|ref|YP_001315283.1| 158878.SAV0143 158879.SA0138 359786.SaurJH9_0129 359787.SaurJH1_0134 418127.SAHV_0142 681288.SAAV_0111 gi|470190411|ref|YP_007576721.1| gi|15925847|ref|NP_373380.1| gi|470194341|ref|YP_007580693.1| gi|384863493|ref|YP_005748852.1| gi|470198272|ref|YP_007584672.1| gi|156978473|ref|YP_001440732.1| gi|148266569|ref|YP_001245512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]