SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470194863|ref|YP_007581215.1| from Staphylococcus aureus ST228/16035

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470194863|ref|YP_007581215.1|
Domain Number 1 Region: 32-272
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.12e-77
Family Phosphate binding protein-like 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470194863|ref|YP_007581215.1|
Sequence length 273
Comment Lipoprotein [Staphylococcus aureus subsp. aureus ST228]
Sequence
MKKLFGLILVLTFAVVLAACGNGNKSGSDDKKITVGASPAPHAEILEKAKPLLEKKGYDL
DIKTINDYTTPNKLLDKGEIDANYFQHTPYLNTEKKDKGYKIVSAGDVHLEPMAVYSKKY
KSLKELPKGATVYVSNNPAEQGRFLKFFVDAGLIKIKKGVKIEDAKFSDITENKKDIKFN
NKQSAEFLPKIYQNEDADAVIINSNFAIEQKLNPKKDSIAVESAKDNPYANLIAVKEGHQ
DDKKIKALIEVLQSKDIQDFINEKYNGAVIPAK
Download sequence
Identical sequences A0A0H3JLB3 A0A0H3JR94 A0A1Q4H289
gi|387149979|ref|YP_005741543.1| gi|470218566|ref|YP_007618960.1| gi|470222387|ref|YP_007620944.1| gi|156979166|ref|YP_001441425.1| gi|470196829|ref|YP_007583230.1| gi|384864140|ref|YP_005749499.1| gi|150393324|ref|YP_001315999.1| gi|15926499|ref|NP_374032.1| gi|470198796|ref|YP_007585196.1| gi|15923829|ref|NP_371363.1| gi|470190933|ref|YP_007577243.1| 158878.SAV0839 158879.SA0771 359786.SaurJH9_0840 359787.SaurJH1_0856 418127.SAHV_0835 gi|148267274|ref|YP_001246217.1| WP_000732324.1.10014 WP_000732324.1.100171 WP_000732324.1.100235 WP_000732324.1.10032 WP_000732324.1.100366 WP_000732324.1.100399 WP_000732324.1.10046 WP_000732324.1.100464 WP_000732324.1.10050 WP_000732324.1.100535 WP_000732324.1.100562 WP_000732324.1.100596 WP_000732324.1.100693 WP_000732324.1.100699 WP_000732324.1.100704 WP_000732324.1.100719 WP_000732324.1.100823 WP_000732324.1.100832 WP_000732324.1.100860 WP_000732324.1.100888 WP_000732324.1.100934 WP_000732324.1.10097 WP_000732324.1.101002 WP_000732324.1.101019 WP_000732324.1.101027 WP_000732324.1.101068 WP_000732324.1.101071 WP_000732324.1.101072 WP_000732324.1.101103 WP_000732324.1.10111 WP_000732324.1.101160 WP_000732324.1.101192 WP_000732324.1.101262 WP_000732324.1.101379 WP_000732324.1.101440 WP_000732324.1.101441 WP_000732324.1.10148 WP_000732324.1.10165 WP_000732324.1.101661 WP_000732324.1.101691 WP_000732324.1.101704 WP_000732324.1.101728 WP_000732324.1.101745 WP_000732324.1.101778 WP_000732324.1.101813 WP_000732324.1.101820 WP_000732324.1.101825 WP_000732324.1.101852 WP_000732324.1.101902 WP_000732324.1.101906 WP_000732324.1.101943 WP_000732324.1.102065 WP_000732324.1.102096 WP_000732324.1.102123 WP_000732324.1.102130 WP_000732324.1.102132 WP_000732324.1.10238 WP_000732324.1.1025 WP_000732324.1.10274 WP_000732324.1.1031 WP_000732324.1.10343 WP_000732324.1.1043 WP_000732324.1.10436 WP_000732324.1.10478 WP_000732324.1.10481 WP_000732324.1.10526 WP_000732324.1.10624 WP_000732324.1.10749 WP_000732324.1.10751 WP_000732324.1.1077 WP_000732324.1.10823 WP_000732324.1.10858 WP_000732324.1.10919 WP_000732324.1.10942 WP_000732324.1.10976 WP_000732324.1.10979 WP_000732324.1.11001 WP_000732324.1.11073 WP_000732324.1.11083 WP_000732324.1.11084 WP_000732324.1.1115 WP_000732324.1.11162 WP_000732324.1.11220 WP_000732324.1.11261 WP_000732324.1.11282 WP_000732324.1.11286 WP_000732324.1.11322 WP_000732324.1.11333 WP_000732324.1.11378 WP_000732324.1.11403 WP_000732324.1.11447 WP_000732324.1.11451 WP_000732324.1.1147 WP_000732324.1.11504 WP_000732324.1.11513 WP_000732324.1.11556 WP_000732324.1.11611 WP_000732324.1.11640 WP_000732324.1.11646 WP_000732324.1.11663 WP_000732324.1.1171 WP_000732324.1.11736 WP_000732324.1.11768 WP_000732324.1.11794 WP_000732324.1.11837 WP_000732324.1.11884 WP_000732324.1.11903 WP_000732324.1.12019 WP_000732324.1.12042 WP_000732324.1.1210 WP_000732324.1.12149 WP_000732324.1.12152 WP_000732324.1.12170 WP_000732324.1.12175 WP_000732324.1.12234 WP_000732324.1.12256 WP_000732324.1.12330 WP_000732324.1.12437 WP_000732324.1.12508 WP_000732324.1.1257 WP_000732324.1.12598 WP_000732324.1.12608 WP_000732324.1.12618 WP_000732324.1.12685 WP_000732324.1.12733 WP_000732324.1.12737 WP_000732324.1.12770 WP_000732324.1.12780 WP_000732324.1.12788 WP_000732324.1.12829 WP_000732324.1.12858 WP_000732324.1.12884 WP_000732324.1.12904 WP_000732324.1.12918 WP_000732324.1.12920 WP_000732324.1.13013 WP_000732324.1.13062 WP_000732324.1.13154 WP_000732324.1.13169 WP_000732324.1.13189 WP_000732324.1.13243 WP_000732324.1.13250 WP_000732324.1.13326 WP_000732324.1.13355 WP_000732324.1.13379 WP_000732324.1.13405 WP_000732324.1.13448 WP_000732324.1.13514 WP_000732324.1.13554 WP_000732324.1.13612 WP_000732324.1.13665 WP_000732324.1.13668 WP_000732324.1.13670 WP_000732324.1.13879 WP_000732324.1.13897 WP_000732324.1.13933 WP_000732324.1.13986 WP_000732324.1.13987 WP_000732324.1.14025 WP_000732324.1.14097 WP_000732324.1.14143 WP_000732324.1.14163 WP_000732324.1.1420 WP_000732324.1.14201 WP_000732324.1.1425 WP_000732324.1.1429 WP_000732324.1.14305 WP_000732324.1.14342 WP_000732324.1.14358 WP_000732324.1.14397 WP_000732324.1.14412 WP_000732324.1.14535 WP_000732324.1.14577 WP_000732324.1.14596 WP_000732324.1.14639 WP_000732324.1.14696 WP_000732324.1.1471 WP_000732324.1.14729 WP_000732324.1.14734 WP_000732324.1.14774 WP_000732324.1.14825 WP_000732324.1.14846 WP_000732324.1.14874 WP_000732324.1.14967 WP_000732324.1.14970 WP_000732324.1.15015 WP_000732324.1.15029 WP_000732324.1.15108 WP_000732324.1.15173 WP_000732324.1.15185 WP_000732324.1.1520 WP_000732324.1.15201 WP_000732324.1.1525 WP_000732324.1.15268 WP_000732324.1.15269 WP_000732324.1.15294 WP_000732324.1.15296 WP_000732324.1.15421 WP_000732324.1.15533 WP_000732324.1.15544 WP_000732324.1.15546 WP_000732324.1.1558 WP_000732324.1.15590 WP_000732324.1.1564 WP_000732324.1.15691 WP_000732324.1.15722 WP_000732324.1.15785 WP_000732324.1.15812 WP_000732324.1.159 WP_000732324.1.15920 WP_000732324.1.15921 WP_000732324.1.15925 WP_000732324.1.16018 WP_000732324.1.16068 WP_000732324.1.16098 WP_000732324.1.16140 WP_000732324.1.16173 WP_000732324.1.16195 WP_000732324.1.16203 WP_000732324.1.16223 WP_000732324.1.1623 WP_000732324.1.16251 WP_000732324.1.16265 WP_000732324.1.16276 WP_000732324.1.16311 WP_000732324.1.16395 WP_000732324.1.16407 WP_000732324.1.16458 WP_000732324.1.16589 WP_000732324.1.16632 WP_000732324.1.16639 WP_000732324.1.1665 WP_000732324.1.16651 WP_000732324.1.16653 WP_000732324.1.16693 WP_000732324.1.16747 WP_000732324.1.16794 WP_000732324.1.16815 WP_000732324.1.16824 WP_000732324.1.16880 WP_000732324.1.16882 WP_000732324.1.16920 WP_000732324.1.16925 WP_000732324.1.16969 WP_000732324.1.17046 WP_000732324.1.17080 WP_000732324.1.17122 WP_000732324.1.17132 WP_000732324.1.17139 WP_000732324.1.17157 WP_000732324.1.17180 WP_000732324.1.17240 WP_000732324.1.17309 WP_000732324.1.17327 WP_000732324.1.1736 WP_000732324.1.1741 WP_000732324.1.17419 WP_000732324.1.17454 WP_000732324.1.17529 WP_000732324.1.17531 WP_000732324.1.1756 WP_000732324.1.17590 WP_000732324.1.17643 WP_000732324.1.1765 WP_000732324.1.17671 WP_000732324.1.17717 WP_000732324.1.17718 WP_000732324.1.17725 WP_000732324.1.17737 WP_000732324.1.17796 WP_000732324.1.17818 WP_000732324.1.17832 WP_000732324.1.17847 WP_000732324.1.17853 WP_000732324.1.17909 WP_000732324.1.17922 WP_000732324.1.17943 WP_000732324.1.17987 WP_000732324.1.18011 WP_000732324.1.18069 WP_000732324.1.18080 WP_000732324.1.18113 WP_000732324.1.18140 WP_000732324.1.18153 WP_000732324.1.18203 WP_000732324.1.18237 WP_000732324.1.18248 WP_000732324.1.18261 WP_000732324.1.18288 WP_000732324.1.1829 WP_000732324.1.18301 WP_000732324.1.18309 WP_000732324.1.18310 WP_000732324.1.18360 WP_000732324.1.18412 WP_000732324.1.18429 WP_000732324.1.1847 WP_000732324.1.18487 WP_000732324.1.18506 WP_000732324.1.18507 WP_000732324.1.18539 WP_000732324.1.18560 WP_000732324.1.18570 WP_000732324.1.18591 WP_000732324.1.18632 WP_000732324.1.18679 WP_000732324.1.18741 WP_000732324.1.18777 WP_000732324.1.18792 WP_000732324.1.18819 WP_000732324.1.18834 WP_000732324.1.18882 WP_000732324.1.1892 WP_000732324.1.18965 WP_000732324.1.18974 WP_000732324.1.18996 WP_000732324.1.19052 WP_000732324.1.19082 WP_000732324.1.1911 WP_000732324.1.19301 WP_000732324.1.19322 WP_000732324.1.19430 WP_000732324.1.19450 WP_000732324.1.19537 WP_000732324.1.19555 WP_000732324.1.19577 WP_000732324.1.19611 WP_000732324.1.1964 WP_000732324.1.19643 WP_000732324.1.19701 WP_000732324.1.19725 WP_000732324.1.19732 WP_000732324.1.1974 WP_000732324.1.19748 WP_000732324.1.19816 WP_000732324.1.19848 WP_000732324.1.19891 WP_000732324.1.19912 WP_000732324.1.19921 WP_000732324.1.19980 WP_000732324.1.19981 WP_000732324.1.19982 WP_000732324.1.20006 WP_000732324.1.20049 WP_000732324.1.20052 WP_000732324.1.2007 WP_000732324.1.20078 WP_000732324.1.2008 WP_000732324.1.20090 WP_000732324.1.20100 WP_000732324.1.20156 WP_000732324.1.20161 WP_000732324.1.20167 WP_000732324.1.20191 WP_000732324.1.20214 WP_000732324.1.20245 WP_000732324.1.20324 WP_000732324.1.20340 WP_000732324.1.20398 WP_000732324.1.20399 WP_000732324.1.20411 WP_000732324.1.20447 WP_000732324.1.20479 WP_000732324.1.20487 WP_000732324.1.20574 WP_000732324.1.20579 WP_000732324.1.20585 WP_000732324.1.20611 WP_000732324.1.20619 WP_000732324.1.20620 WP_000732324.1.20736 WP_000732324.1.20796 WP_000732324.1.20821 WP_000732324.1.20867 WP_000732324.1.20878 WP_000732324.1.20913 WP_000732324.1.20922 WP_000732324.1.20935 WP_000732324.1.20939 WP_000732324.1.20945 WP_000732324.1.20971 WP_000732324.1.21009 WP_000732324.1.21056 WP_000732324.1.21066 WP_000732324.1.21078 WP_000732324.1.21109 WP_000732324.1.21111 WP_000732324.1.21154 WP_000732324.1.21183 WP_000732324.1.2119 WP_000732324.1.21257 WP_000732324.1.21272 WP_000732324.1.21313 WP_000732324.1.21339 WP_000732324.1.2135 WP_000732324.1.21359 WP_000732324.1.21375 WP_000732324.1.21379 WP_000732324.1.21393 WP_000732324.1.21412 WP_000732324.1.21449 WP_000732324.1.21464 WP_000732324.1.21480 WP_000732324.1.21500 WP_000732324.1.21514 WP_000732324.1.21572 WP_000732324.1.2159 WP_000732324.1.2160 WP_000732324.1.21636 WP_000732324.1.21724 WP_000732324.1.21746 WP_000732324.1.21763 WP_000732324.1.21787 WP_000732324.1.21830 WP_000732324.1.21988 WP_000732324.1.22027 WP_000732324.1.22082 WP_000732324.1.22111 WP_000732324.1.22177 WP_000732324.1.22197 WP_000732324.1.22227 WP_000732324.1.22302 WP_000732324.1.22400 WP_000732324.1.22493 WP_000732324.1.22533 WP_000732324.1.22559 WP_000732324.1.22650 WP_000732324.1.22696 WP_000732324.1.22702 WP_000732324.1.22709 WP_000732324.1.22738 WP_000732324.1.22789 WP_000732324.1.22790 WP_000732324.1.22792 WP_000732324.1.22803 WP_000732324.1.22853 WP_000732324.1.22890 WP_000732324.1.22969 WP_000732324.1.23008 WP_000732324.1.23061 WP_000732324.1.23103 WP_000732324.1.23130 WP_000732324.1.23132 WP_000732324.1.23133 WP_000732324.1.23161 WP_000732324.1.23185 WP_000732324.1.23244 WP_000732324.1.2327 WP_000732324.1.23275 WP_000732324.1.23288 WP_000732324.1.23413 WP_000732324.1.23449 WP_000732324.1.23531 WP_000732324.1.23572 WP_000732324.1.23630 WP_000732324.1.23644 WP_000732324.1.23690 WP_000732324.1.23740 WP_000732324.1.23796 WP_000732324.1.23809 WP_000732324.1.23842 WP_000732324.1.2389 WP_000732324.1.23900 WP_000732324.1.23956 WP_000732324.1.23972 WP_000732324.1.23995 WP_000732324.1.24000 WP_000732324.1.24129 WP_000732324.1.24174 WP_000732324.1.24207 WP_000732324.1.24213 WP_000732324.1.24263 WP_000732324.1.2427 WP_000732324.1.24277 WP_000732324.1.24343 WP_000732324.1.24416 WP_000732324.1.24437 WP_000732324.1.24469 WP_000732324.1.2450 WP_000732324.1.24589 WP_000732324.1.24596 WP_000732324.1.24602 WP_000732324.1.24631 WP_000732324.1.24679 WP_000732324.1.24823 WP_000732324.1.24855 WP_000732324.1.2497 WP_000732324.1.25007 WP_000732324.1.2501 WP_000732324.1.25012 WP_000732324.1.2506 WP_000732324.1.25070 WP_000732324.1.25092 WP_000732324.1.25098 WP_000732324.1.25115 WP_000732324.1.25145 WP_000732324.1.25167 WP_000732324.1.25209 WP_000732324.1.25287 WP_000732324.1.25361 WP_000732324.1.25459 WP_000732324.1.25489 WP_000732324.1.2552 WP_000732324.1.25557 WP_000732324.1.25595 WP_000732324.1.25621 WP_000732324.1.25623 WP_000732324.1.25721 WP_000732324.1.25758 WP_000732324.1.25772 WP_000732324.1.25779 WP_000732324.1.25802 WP_000732324.1.25840 WP_000732324.1.25856 WP_000732324.1.25857 WP_000732324.1.2590 WP_000732324.1.25910 WP_000732324.1.25930 WP_000732324.1.26039 WP_000732324.1.2608 WP_000732324.1.26086 WP_000732324.1.26106 WP_000732324.1.26143 WP_000732324.1.26169 WP_000732324.1.2621 WP_000732324.1.26255 WP_000732324.1.26266 WP_000732324.1.26276 WP_000732324.1.26290 WP_000732324.1.26298 WP_000732324.1.26314 WP_000732324.1.26318 WP_000732324.1.26340 WP_000732324.1.26345 WP_000732324.1.26354 WP_000732324.1.26359 WP_000732324.1.26364 WP_000732324.1.26399 WP_000732324.1.26404 WP_000732324.1.2643 WP_000732324.1.26506 WP_000732324.1.26662 WP_000732324.1.26677 WP_000732324.1.26692 WP_000732324.1.2673 WP_000732324.1.26751 WP_000732324.1.26772 WP_000732324.1.26804 WP_000732324.1.2684 WP_000732324.1.26840 WP_000732324.1.26865 WP_000732324.1.26884 WP_000732324.1.2689 WP_000732324.1.26903 WP_000732324.1.26905 WP_000732324.1.26938 WP_000732324.1.26944 WP_000732324.1.27013 WP_000732324.1.27053 WP_000732324.1.27083 WP_000732324.1.27166 WP_000732324.1.27170 WP_000732324.1.27182 WP_000732324.1.2719 WP_000732324.1.27262 WP_000732324.1.27293 WP_000732324.1.27294 WP_000732324.1.27323 WP_000732324.1.27379 WP_000732324.1.27387 WP_000732324.1.27447 WP_000732324.1.27456 WP_000732324.1.27468 WP_000732324.1.2753 WP_000732324.1.27539 WP_000732324.1.27590 WP_000732324.1.27628 WP_000732324.1.27646 WP_000732324.1.27689 WP_000732324.1.27739 WP_000732324.1.27744 WP_000732324.1.27765 WP_000732324.1.27793 WP_000732324.1.27830 WP_000732324.1.2795 WP_000732324.1.28016 WP_000732324.1.28091 WP_000732324.1.28105 WP_000732324.1.28173 WP_000732324.1.28213 WP_000732324.1.28226 WP_000732324.1.28230 WP_000732324.1.28253 WP_000732324.1.28257 WP_000732324.1.28274 WP_000732324.1.28315 WP_000732324.1.28319 WP_000732324.1.28347 WP_000732324.1.28400 WP_000732324.1.28430 WP_000732324.1.2852 WP_000732324.1.28578 WP_000732324.1.28580 WP_000732324.1.28605 WP_000732324.1.28652 WP_000732324.1.28720 WP_000732324.1.28763 WP_000732324.1.28784 WP_000732324.1.28785 WP_000732324.1.28848 WP_000732324.1.28871 WP_000732324.1.28909 WP_000732324.1.28981 WP_000732324.1.28987 WP_000732324.1.29052 WP_000732324.1.29060 WP_000732324.1.29112 WP_000732324.1.29155 WP_000732324.1.29166 WP_000732324.1.29187 WP_000732324.1.29226 WP_000732324.1.29242 WP_000732324.1.29263 WP_000732324.1.29276 WP_000732324.1.29329 WP_000732324.1.29366 WP_000732324.1.29368 WP_000732324.1.29395 WP_000732324.1.29420 WP_000732324.1.29468 WP_000732324.1.29522 WP_000732324.1.2957 WP_000732324.1.2972 WP_000732324.1.29736 WP_000732324.1.29744 WP_000732324.1.29788 WP_000732324.1.2981 WP_000732324.1.29862 WP_000732324.1.29902 WP_000732324.1.29905 WP_000732324.1.29918 WP_000732324.1.29981 WP_000732324.1.30051 WP_000732324.1.30089 WP_000732324.1.30095 WP_000732324.1.30100 WP_000732324.1.30152 WP_000732324.1.30197 WP_000732324.1.30204 WP_000732324.1.30209 WP_000732324.1.30249 WP_000732324.1.30268 WP_000732324.1.30302 WP_000732324.1.30307 WP_000732324.1.30328 WP_000732324.1.30364 WP_000732324.1.30508 WP_000732324.1.30531 WP_000732324.1.30560 WP_000732324.1.30622 WP_000732324.1.30645 WP_000732324.1.30646 WP_000732324.1.30666 WP_000732324.1.30702 WP_000732324.1.30720 WP_000732324.1.30726 WP_000732324.1.30763 WP_000732324.1.3077 WP_000732324.1.30845 WP_000732324.1.30847 WP_000732324.1.30854 WP_000732324.1.31005 WP_000732324.1.31022 WP_000732324.1.31039 WP_000732324.1.31048 WP_000732324.1.31091 WP_000732324.1.31176 WP_000732324.1.31206 WP_000732324.1.3123 WP_000732324.1.31315 WP_000732324.1.31337 WP_000732324.1.31339 WP_000732324.1.31355 WP_000732324.1.31437 WP_000732324.1.31442 WP_000732324.1.31468 WP_000732324.1.31479 WP_000732324.1.31529 WP_000732324.1.31539 WP_000732324.1.31642 WP_000732324.1.31647 WP_000732324.1.31653 WP_000732324.1.31686 WP_000732324.1.31753 WP_000732324.1.31827 WP_000732324.1.31828 WP_000732324.1.31842 WP_000732324.1.31892 WP_000732324.1.31931 WP_000732324.1.31997 WP_000732324.1.32003 WP_000732324.1.32005 WP_000732324.1.32029 WP_000732324.1.32067 WP_000732324.1.32160 WP_000732324.1.32207 WP_000732324.1.3229 WP_000732324.1.32339 WP_000732324.1.3242 WP_000732324.1.32474 WP_000732324.1.32481 WP_000732324.1.32483 WP_000732324.1.32514 WP_000732324.1.32534 WP_000732324.1.32565 WP_000732324.1.32607 WP_000732324.1.32634 WP_000732324.1.32746 WP_000732324.1.32764 WP_000732324.1.32770 WP_000732324.1.32800 WP_000732324.1.32928 WP_000732324.1.32939 WP_000732324.1.32954 WP_000732324.1.33038 WP_000732324.1.33048 WP_000732324.1.33110 WP_000732324.1.33123 WP_000732324.1.33138 WP_000732324.1.33212 WP_000732324.1.33250 WP_000732324.1.33266 WP_000732324.1.33335 WP_000732324.1.33357 WP_000732324.1.33416 WP_000732324.1.3342 WP_000732324.1.33432 WP_000732324.1.33468 WP_000732324.1.3347 WP_000732324.1.33507 WP_000732324.1.33594 WP_000732324.1.33626 WP_000732324.1.33627 WP_000732324.1.3363 WP_000732324.1.33654 WP_000732324.1.33692 WP_000732324.1.33695 WP_000732324.1.33718 WP_000732324.1.33735 WP_000732324.1.33743 WP_000732324.1.33769 WP_000732324.1.33792 WP_000732324.1.33804 WP_000732324.1.33813 WP_000732324.1.33968 WP_000732324.1.33971 WP_000732324.1.33983 WP_000732324.1.34026 WP_000732324.1.34030 WP_000732324.1.34051 WP_000732324.1.34062 WP_000732324.1.34100 WP_000732324.1.34132 WP_000732324.1.34182 WP_000732324.1.34209 WP_000732324.1.34244 WP_000732324.1.34250 WP_000732324.1.34251 WP_000732324.1.34285 WP_000732324.1.34381 WP_000732324.1.34403 WP_000732324.1.34410 WP_000732324.1.34482 WP_000732324.1.34492 WP_000732324.1.34502 WP_000732324.1.34510 WP_000732324.1.34526 WP_000732324.1.3461 WP_000732324.1.34677 WP_000732324.1.34737 WP_000732324.1.34767 WP_000732324.1.34818 WP_000732324.1.34890 WP_000732324.1.34918 WP_000732324.1.34998 WP_000732324.1.35059 WP_000732324.1.35062 WP_000732324.1.35089 WP_000732324.1.35097 WP_000732324.1.35110 WP_000732324.1.35121 WP_000732324.1.35233 WP_000732324.1.35276 WP_000732324.1.35285 WP_000732324.1.35297 WP_000732324.1.35334 WP_000732324.1.35342 WP_000732324.1.354 WP_000732324.1.35415 WP_000732324.1.3547 WP_000732324.1.35498 WP_000732324.1.35525 WP_000732324.1.35580 WP_000732324.1.35615 WP_000732324.1.35623 WP_000732324.1.35673 WP_000732324.1.3569 WP_000732324.1.35801 WP_000732324.1.35826 WP_000732324.1.35900 WP_000732324.1.35928 WP_000732324.1.35950 WP_000732324.1.36004 WP_000732324.1.36082 WP_000732324.1.36102 WP_000732324.1.36119 WP_000732324.1.36141 WP_000732324.1.3617 WP_000732324.1.36176 WP_000732324.1.36187 WP_000732324.1.36188 WP_000732324.1.36250 WP_000732324.1.36264 WP_000732324.1.36278 WP_000732324.1.36282 WP_000732324.1.36307 WP_000732324.1.36344 WP_000732324.1.36389 WP_000732324.1.36532 WP_000732324.1.36535 WP_000732324.1.3655 WP_000732324.1.36570 WP_000732324.1.36580 WP_000732324.1.36600 WP_000732324.1.36615 WP_000732324.1.36646 WP_000732324.1.3666 WP_000732324.1.36689 WP_000732324.1.36697 WP_000732324.1.36745 WP_000732324.1.3675 WP_000732324.1.36783 WP_000732324.1.36796 WP_000732324.1.36822 WP_000732324.1.3685 WP_000732324.1.36858 WP_000732324.1.3687 WP_000732324.1.36955 WP_000732324.1.36979 WP_000732324.1.36980 WP_000732324.1.36997 WP_000732324.1.37002 WP_000732324.1.37016 WP_000732324.1.3703 WP_000732324.1.37044 WP_000732324.1.37055 WP_000732324.1.37080 WP_000732324.1.37121 WP_000732324.1.37134 WP_000732324.1.37220 WP_000732324.1.37341 WP_000732324.1.37398 WP_000732324.1.37424 WP_000732324.1.37467 WP_000732324.1.37583 WP_000732324.1.37602 WP_000732324.1.37605 WP_000732324.1.37606 WP_000732324.1.37621 WP_000732324.1.37624 WP_000732324.1.3776 WP_000732324.1.37781 WP_000732324.1.37815 WP_000732324.1.37828 WP_000732324.1.37953 WP_000732324.1.37987 WP_000732324.1.38038 WP_000732324.1.38057 WP_000732324.1.38070 WP_000732324.1.38082 WP_000732324.1.3809 WP_000732324.1.38160 WP_000732324.1.38177 WP_000732324.1.3820 WP_000732324.1.38230 WP_000732324.1.38232 WP_000732324.1.38276 WP_000732324.1.38282 WP_000732324.1.38309 WP_000732324.1.38339 WP_000732324.1.3842 WP_000732324.1.38437 WP_000732324.1.38453 WP_000732324.1.38493 WP_000732324.1.38522 WP_000732324.1.38607 WP_000732324.1.38612 WP_000732324.1.3867 WP_000732324.1.38674 WP_000732324.1.38721 WP_000732324.1.38760 WP_000732324.1.38823 WP_000732324.1.38841 WP_000732324.1.38858 WP_000732324.1.38926 WP_000732324.1.38931 WP_000732324.1.38940 WP_000732324.1.38941 WP_000732324.1.38972 WP_000732324.1.38989 WP_000732324.1.390 WP_000732324.1.39012 WP_000732324.1.39014 WP_000732324.1.39043 WP_000732324.1.39053 WP_000732324.1.3906 WP_000732324.1.391 WP_000732324.1.39108 WP_000732324.1.39203 WP_000732324.1.39206 WP_000732324.1.39217 WP_000732324.1.3926 WP_000732324.1.39272 WP_000732324.1.39290 WP_000732324.1.39332 WP_000732324.1.39333 WP_000732324.1.39397 WP_000732324.1.39406 WP_000732324.1.39486 WP_000732324.1.39506 WP_000732324.1.39550 WP_000732324.1.39645 WP_000732324.1.39687 WP_000732324.1.39689 WP_000732324.1.39697 WP_000732324.1.39711 WP_000732324.1.39738 WP_000732324.1.39789 WP_000732324.1.39832 WP_000732324.1.39838 WP_000732324.1.39856 WP_000732324.1.39869 WP_000732324.1.40014 WP_000732324.1.40043 WP_000732324.1.40099 WP_000732324.1.40120 WP_000732324.1.40137 WP_000732324.1.4015 WP_000732324.1.40164 WP_000732324.1.40173 WP_000732324.1.4019 WP_000732324.1.40318 WP_000732324.1.40320 WP_000732324.1.40330 WP_000732324.1.40342 WP_000732324.1.40368 WP_000732324.1.40406 WP_000732324.1.4045 WP_000732324.1.40474 WP_000732324.1.40481 WP_000732324.1.40505 WP_000732324.1.40531 WP_000732324.1.40532 WP_000732324.1.4056 WP_000732324.1.40579 WP_000732324.1.40588 WP_000732324.1.40620 WP_000732324.1.40644 WP_000732324.1.40655 WP_000732324.1.40658 WP_000732324.1.40659 WP_000732324.1.40760 WP_000732324.1.40797 WP_000732324.1.40816 WP_000732324.1.41064 WP_000732324.1.41084 WP_000732324.1.41094 WP_000732324.1.41119 WP_000732324.1.41129 WP_000732324.1.4115 WP_000732324.1.41178 WP_000732324.1.41208 WP_000732324.1.41241 WP_000732324.1.41289 WP_000732324.1.4129 WP_000732324.1.41426 WP_000732324.1.41432 WP_000732324.1.41433 WP_000732324.1.41499 WP_000732324.1.41558 WP_000732324.1.41567 WP_000732324.1.41582 WP_000732324.1.41674 WP_000732324.1.41839 WP_000732324.1.4188 WP_000732324.1.41898 WP_000732324.1.41935 WP_000732324.1.41943 WP_000732324.1.41989 WP_000732324.1.420 WP_000732324.1.42015 WP_000732324.1.42017 WP_000732324.1.42028 WP_000732324.1.42087 WP_000732324.1.42125 WP_000732324.1.42137 WP_000732324.1.42198 WP_000732324.1.42269 WP_000732324.1.42305 WP_000732324.1.42355 WP_000732324.1.42403 WP_000732324.1.42436 WP_000732324.1.42459 WP_000732324.1.42481 WP_000732324.1.42510 WP_000732324.1.42593 WP_000732324.1.426 WP_000732324.1.42640 WP_000732324.1.42652 WP_000732324.1.42668 WP_000732324.1.42674 WP_000732324.1.42737 WP_000732324.1.42759 WP_000732324.1.42786 WP_000732324.1.42837 WP_000732324.1.4293 WP_000732324.1.4299 WP_000732324.1.43014 WP_000732324.1.43047 WP_000732324.1.43072 WP_000732324.1.43122 WP_000732324.1.43131 WP_000732324.1.43134 WP_000732324.1.43143 WP_000732324.1.43147 WP_000732324.1.43159 WP_000732324.1.43165 WP_000732324.1.43202 WP_000732324.1.43232 WP_000732324.1.43248 WP_000732324.1.4325 WP_000732324.1.43263 WP_000732324.1.4327 WP_000732324.1.43274 WP_000732324.1.43323 WP_000732324.1.43341 WP_000732324.1.43349 WP_000732324.1.43369 WP_000732324.1.4337 WP_000732324.1.43406 WP_000732324.1.4341 WP_000732324.1.43460 WP_000732324.1.4347 WP_000732324.1.43550 WP_000732324.1.43560 WP_000732324.1.43617 WP_000732324.1.43618 WP_000732324.1.43627 WP_000732324.1.43659 WP_000732324.1.43670 WP_000732324.1.43702 WP_000732324.1.43703 WP_000732324.1.4372 WP_000732324.1.43731 WP_000732324.1.43752 WP_000732324.1.43788 WP_000732324.1.43819 WP_000732324.1.43827 WP_000732324.1.4385 WP_000732324.1.43904 WP_000732324.1.43915 WP_000732324.1.44119 WP_000732324.1.44153 WP_000732324.1.44181 WP_000732324.1.44195 WP_000732324.1.44265 WP_000732324.1.44302 WP_000732324.1.44388 WP_000732324.1.44396 WP_000732324.1.44405 WP_000732324.1.44420 WP_000732324.1.44544 WP_000732324.1.44579 WP_000732324.1.44588 WP_000732324.1.44605 WP_000732324.1.44631 WP_000732324.1.44672 WP_000732324.1.44732 WP_000732324.1.44755 WP_000732324.1.44785 WP_000732324.1.44788 WP_000732324.1.44796 WP_000732324.1.44881 WP_000732324.1.44882 WP_000732324.1.44914 WP_000732324.1.44955 WP_000732324.1.44969 WP_000732324.1.45033 WP_000732324.1.45035 WP_000732324.1.45099 WP_000732324.1.4513 WP_000732324.1.45133 WP_000732324.1.45164 WP_000732324.1.45170 WP_000732324.1.45272 WP_000732324.1.45290 WP_000732324.1.45297 WP_000732324.1.453 WP_000732324.1.45364 WP_000732324.1.45431 WP_000732324.1.45439 WP_000732324.1.45472 WP_000732324.1.4550 WP_000732324.1.45507 WP_000732324.1.45560 WP_000732324.1.45577 WP_000732324.1.45670 WP_000732324.1.45703 WP_000732324.1.45730 WP_000732324.1.45734 WP_000732324.1.45768 WP_000732324.1.45771 WP_000732324.1.45780 WP_000732324.1.4584 WP_000732324.1.45852 WP_000732324.1.45897 WP_000732324.1.45954 WP_000732324.1.4598 WP_000732324.1.46003 WP_000732324.1.46005 WP_000732324.1.46055 WP_000732324.1.46087 WP_000732324.1.46168 WP_000732324.1.46208 WP_000732324.1.46222 WP_000732324.1.46228 WP_000732324.1.46276 WP_000732324.1.46330 WP_000732324.1.46334 WP_000732324.1.46362 WP_000732324.1.46368 WP_000732324.1.46380 WP_000732324.1.46401 WP_000732324.1.46422 WP_000732324.1.46465 WP_000732324.1.46543 WP_000732324.1.4662 WP_000732324.1.46660 WP_000732324.1.46664 WP_000732324.1.46670 WP_000732324.1.46692 WP_000732324.1.46702 WP_000732324.1.46703 WP_000732324.1.46752 WP_000732324.1.46765 WP_000732324.1.46852 WP_000732324.1.46881 WP_000732324.1.46908 WP_000732324.1.46925 WP_000732324.1.46937 WP_000732324.1.4696 WP_000732324.1.46983 WP_000732324.1.46995 WP_000732324.1.47051 WP_000732324.1.47128 WP_000732324.1.47153 WP_000732324.1.47159 WP_000732324.1.47163 WP_000732324.1.47187 WP_000732324.1.47211 WP_000732324.1.47216 WP_000732324.1.47258 WP_000732324.1.47269 WP_000732324.1.47279 WP_000732324.1.4728 WP_000732324.1.47290 WP_000732324.1.47294 WP_000732324.1.47306 WP_000732324.1.47328 WP_000732324.1.47381 WP_000732324.1.47399 WP_000732324.1.47406 WP_000732324.1.47426 WP_000732324.1.47432 WP_000732324.1.47439 WP_000732324.1.47618 WP_000732324.1.4767 WP_000732324.1.477 WP_000732324.1.47733 WP_000732324.1.47763 WP_000732324.1.47782 WP_000732324.1.47836 WP_000732324.1.47859 WP_000732324.1.47872 WP_000732324.1.47873 WP_000732324.1.47904 WP_000732324.1.47996 WP_000732324.1.48011 WP_000732324.1.48030 WP_000732324.1.48047 WP_000732324.1.4805 WP_000732324.1.4815 WP_000732324.1.48154 WP_000732324.1.48169 WP_000732324.1.48227 WP_000732324.1.48236 WP_000732324.1.48250 WP_000732324.1.48284 WP_000732324.1.48293 WP_000732324.1.48307 WP_000732324.1.48322 WP_000732324.1.48391 WP_000732324.1.48394 WP_000732324.1.48463 WP_000732324.1.48563 WP_000732324.1.48577 WP_000732324.1.48593 WP_000732324.1.48634 WP_000732324.1.48656 WP_000732324.1.4868 WP_000732324.1.48705 WP_000732324.1.48711 WP_000732324.1.48805 WP_000732324.1.48823 WP_000732324.1.48833 WP_000732324.1.48835 WP_000732324.1.4886 WP_000732324.1.48936 WP_000732324.1.48941 WP_000732324.1.48945 WP_000732324.1.48951 WP_000732324.1.48968 WP_000732324.1.48982 WP_000732324.1.48993 WP_000732324.1.4901 WP_000732324.1.4905 WP_000732324.1.49129 WP_000732324.1.49159 WP_000732324.1.4916 WP_000732324.1.49161 WP_000732324.1.4917 WP_000732324.1.4918 WP_000732324.1.49207 WP_000732324.1.49248 WP_000732324.1.49327 WP_000732324.1.49398 WP_000732324.1.4950 WP_000732324.1.4962 WP_000732324.1.49653 WP_000732324.1.49669 WP_000732324.1.49730 WP_000732324.1.49742 WP_000732324.1.4980 WP_000732324.1.49800 WP_000732324.1.49860 WP_000732324.1.49863 WP_000732324.1.49871 WP_000732324.1.4989 WP_000732324.1.49894 WP_000732324.1.49907 WP_000732324.1.49934 WP_000732324.1.4994 WP_000732324.1.49970 WP_000732324.1.49982 WP_000732324.1.50013 WP_000732324.1.50038 WP_000732324.1.50039 WP_000732324.1.50061 WP_000732324.1.50076 WP_000732324.1.5013 WP_000732324.1.50138 WP_000732324.1.50219 WP_000732324.1.50261 WP_000732324.1.50313 WP_000732324.1.50314 WP_000732324.1.50356 WP_000732324.1.50425 WP_000732324.1.50430 WP_000732324.1.50536 WP_000732324.1.50555 WP_000732324.1.50578 WP_000732324.1.50595 WP_000732324.1.50660 WP_000732324.1.50768 WP_000732324.1.50799 WP_000732324.1.50820 WP_000732324.1.50884 WP_000732324.1.50896 WP_000732324.1.50937 WP_000732324.1.50962 WP_000732324.1.5109 WP_000732324.1.5110 WP_000732324.1.5111 WP_000732324.1.51152 WP_000732324.1.51236 WP_000732324.1.51245 WP_000732324.1.51250 WP_000732324.1.51282 WP_000732324.1.51295 WP_000732324.1.51306 WP_000732324.1.51310 WP_000732324.1.51346 WP_000732324.1.51376 WP_000732324.1.51403 WP_000732324.1.51454 WP_000732324.1.51456 WP_000732324.1.51492 WP_000732324.1.515 WP_000732324.1.51527 WP_000732324.1.5155 WP_000732324.1.51559 WP_000732324.1.51575 WP_000732324.1.51590 WP_000732324.1.51665 WP_000732324.1.51716 WP_000732324.1.51748 WP_000732324.1.51797 WP_000732324.1.51836 WP_000732324.1.51842 WP_000732324.1.51844 WP_000732324.1.51871 WP_000732324.1.51883 WP_000732324.1.51924 WP_000732324.1.51936 WP_000732324.1.51952 WP_000732324.1.51971 WP_000732324.1.51995 WP_000732324.1.52078 WP_000732324.1.521 WP_000732324.1.5213 WP_000732324.1.52182 WP_000732324.1.52185 WP_000732324.1.52193 WP_000732324.1.52251 WP_000732324.1.52296 WP_000732324.1.523 WP_000732324.1.52322 WP_000732324.1.52327 WP_000732324.1.52331 WP_000732324.1.52340 WP_000732324.1.52440 WP_000732324.1.52442 WP_000732324.1.52463 WP_000732324.1.52518 WP_000732324.1.52548 WP_000732324.1.52595 WP_000732324.1.52623 WP_000732324.1.52624 WP_000732324.1.52645 WP_000732324.1.52687 WP_000732324.1.52699 WP_000732324.1.52715 WP_000732324.1.52722 WP_000732324.1.52878 WP_000732324.1.52941 WP_000732324.1.52947 WP_000732324.1.52984 WP_000732324.1.53002 WP_000732324.1.53071 WP_000732324.1.53140 WP_000732324.1.53153 WP_000732324.1.53178 WP_000732324.1.53209 WP_000732324.1.53260 WP_000732324.1.53317 WP_000732324.1.53319 WP_000732324.1.53387 WP_000732324.1.53394 WP_000732324.1.53403 WP_000732324.1.53432 WP_000732324.1.53462 WP_000732324.1.53521 WP_000732324.1.53577 WP_000732324.1.53641 WP_000732324.1.53648 WP_000732324.1.53671 WP_000732324.1.53766 WP_000732324.1.53827 WP_000732324.1.53835 WP_000732324.1.53889 WP_000732324.1.53915 WP_000732324.1.53934 WP_000732324.1.53969 WP_000732324.1.53999 WP_000732324.1.5401 WP_000732324.1.54022 WP_000732324.1.54109 WP_000732324.1.54147 WP_000732324.1.54229 WP_000732324.1.54253 WP_000732324.1.54297 WP_000732324.1.54395 WP_000732324.1.544 WP_000732324.1.54413 WP_000732324.1.54503 WP_000732324.1.54510 WP_000732324.1.54551 WP_000732324.1.54675 WP_000732324.1.5469 WP_000732324.1.54745 WP_000732324.1.54753 WP_000732324.1.54878 WP_000732324.1.54955 WP_000732324.1.55014 WP_000732324.1.5519 WP_000732324.1.55214 WP_000732324.1.55274 WP_000732324.1.55309 WP_000732324.1.55367 WP_000732324.1.55369 WP_000732324.1.55403 WP_000732324.1.55405 WP_000732324.1.55421 WP_000732324.1.55508 WP_000732324.1.5554 WP_000732324.1.55544 WP_000732324.1.55558 WP_000732324.1.5556 WP_000732324.1.55583 WP_000732324.1.5559 WP_000732324.1.55628 WP_000732324.1.55637 WP_000732324.1.55653 WP_000732324.1.557 WP_000732324.1.55728 WP_000732324.1.55786 WP_000732324.1.5580 WP_000732324.1.55818 WP_000732324.1.55831 WP_000732324.1.55835 WP_000732324.1.55867 WP_000732324.1.55886 WP_000732324.1.5589 WP_000732324.1.55904 WP_000732324.1.55916 WP_000732324.1.55933 WP_000732324.1.55953 WP_000732324.1.56000 WP_000732324.1.56025 WP_000732324.1.56048 WP_000732324.1.56098 WP_000732324.1.56225 WP_000732324.1.5623 WP_000732324.1.56239 WP_000732324.1.56281 WP_000732324.1.56333 WP_000732324.1.5635 WP_000732324.1.56400 WP_000732324.1.5644 WP_000732324.1.56558 WP_000732324.1.5658 WP_000732324.1.56598 WP_000732324.1.566 WP_000732324.1.56628 WP_000732324.1.56641 WP_000732324.1.56658 WP_000732324.1.5666 WP_000732324.1.5677 WP_000732324.1.56778 WP_000732324.1.56794 WP_000732324.1.56815 WP_000732324.1.56856 WP_000732324.1.5686 WP_000732324.1.56865 WP_000732324.1.56878 WP_000732324.1.569 WP_000732324.1.56986 WP_000732324.1.57047 WP_000732324.1.57073 WP_000732324.1.57075 WP_000732324.1.57097 WP_000732324.1.57109 WP_000732324.1.57170 WP_000732324.1.5718 WP_000732324.1.57190 WP_000732324.1.57214 WP_000732324.1.57265 WP_000732324.1.57309 WP_000732324.1.57445 WP_000732324.1.57481 WP_000732324.1.57594 WP_000732324.1.57650 WP_000732324.1.57665 WP_000732324.1.57682 WP_000732324.1.57692 WP_000732324.1.57730 WP_000732324.1.57734 WP_000732324.1.57754 WP_000732324.1.57808 WP_000732324.1.57819 WP_000732324.1.57837 WP_000732324.1.57840 WP_000732324.1.57861 WP_000732324.1.57878 WP_000732324.1.5791 WP_000732324.1.57943 WP_000732324.1.57952 WP_000732324.1.57974 WP_000732324.1.58016 WP_000732324.1.58049 WP_000732324.1.58074 WP_000732324.1.58116 WP_000732324.1.58127 WP_000732324.1.58148 WP_000732324.1.58158 WP_000732324.1.5816 WP_000732324.1.58277 WP_000732324.1.58317 WP_000732324.1.58352 WP_000732324.1.58364 WP_000732324.1.58395 WP_000732324.1.58430 WP_000732324.1.58435 WP_000732324.1.58512 WP_000732324.1.58530 WP_000732324.1.5857 WP_000732324.1.58571 WP_000732324.1.58592 WP_000732324.1.58598 WP_000732324.1.58704 WP_000732324.1.58735 WP_000732324.1.58760 WP_000732324.1.58763 WP_000732324.1.58772 WP_000732324.1.5880 WP_000732324.1.58833 WP_000732324.1.58934 WP_000732324.1.58981 WP_000732324.1.59011 WP_000732324.1.59014 WP_000732324.1.59039 WP_000732324.1.59077 WP_000732324.1.59098 WP_000732324.1.59124 WP_000732324.1.59146 WP_000732324.1.5920 WP_000732324.1.59311 WP_000732324.1.59398 WP_000732324.1.5940 WP_000732324.1.59404 WP_000732324.1.59462 WP_000732324.1.59464 WP_000732324.1.59498 WP_000732324.1.59540 WP_000732324.1.59546 WP_000732324.1.59598 WP_000732324.1.59668 WP_000732324.1.59669 WP_000732324.1.59671 WP_000732324.1.5972 WP_000732324.1.59787 WP_000732324.1.5982 WP_000732324.1.59822 WP_000732324.1.59874 WP_000732324.1.59907 WP_000732324.1.59915 WP_000732324.1.60006 WP_000732324.1.6006 WP_000732324.1.6011 WP_000732324.1.60123 WP_000732324.1.60147 WP_000732324.1.60149 WP_000732324.1.60157 WP_000732324.1.6017 WP_000732324.1.60227 WP_000732324.1.60302 WP_000732324.1.60345 WP_000732324.1.60353 WP_000732324.1.60360 WP_000732324.1.60434 WP_000732324.1.60492 WP_000732324.1.60547 WP_000732324.1.60585 WP_000732324.1.60595 WP_000732324.1.60636 WP_000732324.1.60641 WP_000732324.1.60734 WP_000732324.1.60750 WP_000732324.1.60751 WP_000732324.1.60758 WP_000732324.1.60759 WP_000732324.1.60765 WP_000732324.1.60778 WP_000732324.1.60813 WP_000732324.1.60820 WP_000732324.1.60845 WP_000732324.1.6085 WP_000732324.1.60869 WP_000732324.1.60888 WP_000732324.1.60912 WP_000732324.1.60923 WP_000732324.1.60948 WP_000732324.1.60965 WP_000732324.1.60991 WP_000732324.1.61013 WP_000732324.1.61023 WP_000732324.1.61026 WP_000732324.1.61029 WP_000732324.1.61031 WP_000732324.1.61082 WP_000732324.1.61115 WP_000732324.1.61139 WP_000732324.1.61189 WP_000732324.1.6119 WP_000732324.1.6123 WP_000732324.1.61263 WP_000732324.1.61271 WP_000732324.1.61286 WP_000732324.1.61289 WP_000732324.1.61313 WP_000732324.1.61316 WP_000732324.1.6136 WP_000732324.1.61375 WP_000732324.1.61430 WP_000732324.1.61439 WP_000732324.1.61440 WP_000732324.1.61555 WP_000732324.1.61585 WP_000732324.1.61597 WP_000732324.1.61615 WP_000732324.1.61639 WP_000732324.1.6166 WP_000732324.1.61705 WP_000732324.1.61749 WP_000732324.1.61800 WP_000732324.1.61802 WP_000732324.1.61838 WP_000732324.1.61903 WP_000732324.1.61936 WP_000732324.1.61978 WP_000732324.1.62002 WP_000732324.1.6201 WP_000732324.1.62028 WP_000732324.1.62069 WP_000732324.1.62071 WP_000732324.1.62096 WP_000732324.1.62247 WP_000732324.1.62254 WP_000732324.1.62346 WP_000732324.1.62352 WP_000732324.1.62382 WP_000732324.1.62398 WP_000732324.1.62429 WP_000732324.1.62453 WP_000732324.1.62474 WP_000732324.1.62496 WP_000732324.1.6250 WP_000732324.1.62553 WP_000732324.1.62602 WP_000732324.1.62653 WP_000732324.1.62671 WP_000732324.1.62674 WP_000732324.1.6268 WP_000732324.1.62684 WP_000732324.1.62723 WP_000732324.1.62764 WP_000732324.1.62771 WP_000732324.1.62822 WP_000732324.1.62824 WP_000732324.1.62831 WP_000732324.1.62863 WP_000732324.1.62880 WP_000732324.1.62970 WP_000732324.1.63003 WP_000732324.1.63027 WP_000732324.1.63052 WP_000732324.1.63070 WP_000732324.1.63083 WP_000732324.1.63139 WP_000732324.1.63140 WP_000732324.1.63220 WP_000732324.1.63266 WP_000732324.1.63289 WP_000732324.1.63304 WP_000732324.1.63313 WP_000732324.1.63333 WP_000732324.1.63341 WP_000732324.1.63441 WP_000732324.1.63469 WP_000732324.1.63471 WP_000732324.1.63589 WP_000732324.1.63673 WP_000732324.1.63678 WP_000732324.1.63726 WP_000732324.1.63729 WP_000732324.1.63751 WP_000732324.1.63759 WP_000732324.1.63774 WP_000732324.1.63828 WP_000732324.1.6388 WP_000732324.1.63907 WP_000732324.1.6403 WP_000732324.1.6408 WP_000732324.1.64192 WP_000732324.1.64250 WP_000732324.1.64367 WP_000732324.1.6438 WP_000732324.1.64456 WP_000732324.1.64457 WP_000732324.1.64525 WP_000732324.1.64565 WP_000732324.1.64583 WP_000732324.1.6459 WP_000732324.1.6462 WP_000732324.1.64677 WP_000732324.1.64686 WP_000732324.1.64720 WP_000732324.1.64765 WP_000732324.1.6479 WP_000732324.1.64858 WP_000732324.1.64879 WP_000732324.1.6488 WP_000732324.1.64893 WP_000732324.1.64897 WP_000732324.1.64928 WP_000732324.1.64935 WP_000732324.1.64961 WP_000732324.1.65044 WP_000732324.1.65132 WP_000732324.1.65158 WP_000732324.1.65180 WP_000732324.1.65193 WP_000732324.1.65217 WP_000732324.1.65243 WP_000732324.1.65317 WP_000732324.1.65367 WP_000732324.1.65419 WP_000732324.1.65423 WP_000732324.1.65432 WP_000732324.1.65443 WP_000732324.1.65451 WP_000732324.1.6547 WP_000732324.1.65504 WP_000732324.1.6551 WP_000732324.1.65520 WP_000732324.1.65544 WP_000732324.1.65562 WP_000732324.1.65675 WP_000732324.1.65689 WP_000732324.1.65693 WP_000732324.1.65700 WP_000732324.1.65703 WP_000732324.1.65705 WP_000732324.1.65856 WP_000732324.1.65922 WP_000732324.1.65931 WP_000732324.1.66009 WP_000732324.1.66081 WP_000732324.1.661 WP_000732324.1.66120 WP_000732324.1.66133 WP_000732324.1.66175 WP_000732324.1.66262 WP_000732324.1.66302 WP_000732324.1.66433 WP_000732324.1.66505 WP_000732324.1.66519 WP_000732324.1.66542 WP_000732324.1.66564 WP_000732324.1.66588 WP_000732324.1.66601 WP_000732324.1.66606 WP_000732324.1.66664 WP_000732324.1.66677 WP_000732324.1.66711 WP_000732324.1.6674 WP_000732324.1.66786 WP_000732324.1.66818 WP_000732324.1.6684 WP_000732324.1.67112 WP_000732324.1.67135 WP_000732324.1.67191 WP_000732324.1.6722 WP_000732324.1.67266 WP_000732324.1.67329 WP_000732324.1.67333 WP_000732324.1.67379 WP_000732324.1.6740 WP_000732324.1.67414 WP_000732324.1.67463 WP_000732324.1.67480 WP_000732324.1.67505 WP_000732324.1.67507 WP_000732324.1.67520 WP_000732324.1.67521 WP_000732324.1.67554 WP_000732324.1.67572 WP_000732324.1.67632 WP_000732324.1.67651 WP_000732324.1.67652 WP_000732324.1.67713 WP_000732324.1.67722 WP_000732324.1.67754 WP_000732324.1.67815 WP_000732324.1.6786 WP_000732324.1.67865 WP_000732324.1.67925 WP_000732324.1.67986 WP_000732324.1.68033 WP_000732324.1.68054 WP_000732324.1.68066 WP_000732324.1.6811 WP_000732324.1.68111 WP_000732324.1.68160 WP_000732324.1.68161 WP_000732324.1.68199 WP_000732324.1.68261 WP_000732324.1.68295 WP_000732324.1.6830 WP_000732324.1.68307 WP_000732324.1.6834 WP_000732324.1.68343 WP_000732324.1.68351 WP_000732324.1.68367 WP_000732324.1.6839 WP_000732324.1.68397 WP_000732324.1.68425 WP_000732324.1.68483 WP_000732324.1.68489 WP_000732324.1.68522 WP_000732324.1.68565 WP_000732324.1.68650 WP_000732324.1.68699 WP_000732324.1.68703 WP_000732324.1.68728 WP_000732324.1.68737 WP_000732324.1.68775 WP_000732324.1.68813 WP_000732324.1.68831 WP_000732324.1.68854 WP_000732324.1.68875 WP_000732324.1.68943 WP_000732324.1.68944 WP_000732324.1.69045 WP_000732324.1.69087 WP_000732324.1.69089 WP_000732324.1.6917 WP_000732324.1.69191 WP_000732324.1.69219 WP_000732324.1.69222 WP_000732324.1.69237 WP_000732324.1.69366 WP_000732324.1.69395 WP_000732324.1.69415 WP_000732324.1.69476 WP_000732324.1.69480 WP_000732324.1.695 WP_000732324.1.69563 WP_000732324.1.69622 WP_000732324.1.69679 WP_000732324.1.69877 WP_000732324.1.69878 WP_000732324.1.69921 WP_000732324.1.69987 WP_000732324.1.70024 WP_000732324.1.70048 WP_000732324.1.70105 WP_000732324.1.7012 WP_000732324.1.70133 WP_000732324.1.7024 WP_000732324.1.70253 WP_000732324.1.70273 WP_000732324.1.7034 WP_000732324.1.70344 WP_000732324.1.70349 WP_000732324.1.7043 WP_000732324.1.70451 WP_000732324.1.70459 WP_000732324.1.70462 WP_000732324.1.7053 WP_000732324.1.70546 WP_000732324.1.7061 WP_000732324.1.70635 WP_000732324.1.70641 WP_000732324.1.7067 WP_000732324.1.7073 WP_000732324.1.70818 WP_000732324.1.70823 WP_000732324.1.70855 WP_000732324.1.70924 WP_000732324.1.70930 WP_000732324.1.70943 WP_000732324.1.71043 WP_000732324.1.71058 WP_000732324.1.71059 WP_000732324.1.71073 WP_000732324.1.7109 WP_000732324.1.71130 WP_000732324.1.71196 WP_000732324.1.7120 WP_000732324.1.7125 WP_000732324.1.71257 WP_000732324.1.71295 WP_000732324.1.71298 WP_000732324.1.71325 WP_000732324.1.71345 WP_000732324.1.71359 WP_000732324.1.71463 WP_000732324.1.7150 WP_000732324.1.71519 WP_000732324.1.71529 WP_000732324.1.71543 WP_000732324.1.71596 WP_000732324.1.71602 WP_000732324.1.7161 WP_000732324.1.71662 WP_000732324.1.71676 WP_000732324.1.7179 WP_000732324.1.71861 WP_000732324.1.71925 WP_000732324.1.71989 WP_000732324.1.72031 WP_000732324.1.72067 WP_000732324.1.72169 WP_000732324.1.72205 WP_000732324.1.72271 WP_000732324.1.72330 WP_000732324.1.72347 WP_000732324.1.7236 WP_000732324.1.72366 WP_000732324.1.72424 WP_000732324.1.72547 WP_000732324.1.72654 WP_000732324.1.72787 WP_000732324.1.72832 WP_000732324.1.72834 WP_000732324.1.72835 WP_000732324.1.72904 WP_000732324.1.72935 WP_000732324.1.72945 WP_000732324.1.73017 WP_000732324.1.73019 WP_000732324.1.73022 WP_000732324.1.73037 WP_000732324.1.73122 WP_000732324.1.73132 WP_000732324.1.73246 WP_000732324.1.73265 WP_000732324.1.73286 WP_000732324.1.73386 WP_000732324.1.73456 WP_000732324.1.73501 WP_000732324.1.73571 WP_000732324.1.73591 WP_000732324.1.736 WP_000732324.1.73639 WP_000732324.1.73685 WP_000732324.1.73735 WP_000732324.1.73759 WP_000732324.1.73786 WP_000732324.1.7380 WP_000732324.1.73834 WP_000732324.1.73858 WP_000732324.1.73910 WP_000732324.1.73920 WP_000732324.1.73961 WP_000732324.1.73969 WP_000732324.1.73976 WP_000732324.1.73983 WP_000732324.1.74006 WP_000732324.1.74027 WP_000732324.1.74081 WP_000732324.1.74157 WP_000732324.1.74161 WP_000732324.1.74173 WP_000732324.1.74183 WP_000732324.1.74216 WP_000732324.1.74234 WP_000732324.1.74237 WP_000732324.1.7427 WP_000732324.1.7434 WP_000732324.1.74353 WP_000732324.1.74356 WP_000732324.1.74380 WP_000732324.1.74429 WP_000732324.1.74457 WP_000732324.1.7457 WP_000732324.1.74587 WP_000732324.1.74610 WP_000732324.1.74638 WP_000732324.1.74696 WP_000732324.1.74704 WP_000732324.1.74747 WP_000732324.1.74802 WP_000732324.1.74866 WP_000732324.1.74890 WP_000732324.1.74911 WP_000732324.1.74922 WP_000732324.1.74961 WP_000732324.1.74994 WP_000732324.1.74999 WP_000732324.1.75038 WP_000732324.1.75044 WP_000732324.1.75052 WP_000732324.1.75186 WP_000732324.1.75227 WP_000732324.1.75252 WP_000732324.1.75253 WP_000732324.1.75294 WP_000732324.1.75298 WP_000732324.1.75320 WP_000732324.1.75327 WP_000732324.1.75349 WP_000732324.1.75365 WP_000732324.1.75399 WP_000732324.1.7542 WP_000732324.1.75438 WP_000732324.1.75440 WP_000732324.1.75527 WP_000732324.1.75551 WP_000732324.1.7561 WP_000732324.1.75649 WP_000732324.1.75652 WP_000732324.1.75685 WP_000732324.1.75769 WP_000732324.1.75775 WP_000732324.1.758 WP_000732324.1.75830 WP_000732324.1.75881 WP_000732324.1.75885 WP_000732324.1.75929 WP_000732324.1.75952 WP_000732324.1.7596 WP_000732324.1.75969 WP_000732324.1.76010 WP_000732324.1.76015 WP_000732324.1.76095 WP_000732324.1.76143 WP_000732324.1.76230 WP_000732324.1.76234 WP_000732324.1.7624 WP_000732324.1.7625 WP_000732324.1.76258 WP_000732324.1.76261 WP_000732324.1.76332 WP_000732324.1.76337 WP_000732324.1.76351 WP_000732324.1.76419 WP_000732324.1.76420 WP_000732324.1.76421 WP_000732324.1.76606 WP_000732324.1.76624 WP_000732324.1.76686 WP_000732324.1.76690 WP_000732324.1.76693 WP_000732324.1.7675 WP_000732324.1.76790 WP_000732324.1.76792 WP_000732324.1.768 WP_000732324.1.76816 WP_000732324.1.76839 WP_000732324.1.76845 WP_000732324.1.76897 WP_000732324.1.76921 WP_000732324.1.76944 WP_000732324.1.76952 WP_000732324.1.76998 WP_000732324.1.77031 WP_000732324.1.77041 WP_000732324.1.77050 WP_000732324.1.77060 WP_000732324.1.77062 WP_000732324.1.77112 WP_000732324.1.77145 WP_000732324.1.77305 WP_000732324.1.7745 WP_000732324.1.7746 WP_000732324.1.77489 WP_000732324.1.77497 WP_000732324.1.77520 WP_000732324.1.77527 WP_000732324.1.77533 WP_000732324.1.77536 WP_000732324.1.77572 WP_000732324.1.77603 WP_000732324.1.77606 WP_000732324.1.77738 WP_000732324.1.7774 WP_000732324.1.77743 WP_000732324.1.77818 WP_000732324.1.77822 WP_000732324.1.77848 WP_000732324.1.77858 WP_000732324.1.7787 WP_000732324.1.78054 WP_000732324.1.78091 WP_000732324.1.78173 WP_000732324.1.78189 WP_000732324.1.78252 WP_000732324.1.78254 WP_000732324.1.78257 WP_000732324.1.7827 WP_000732324.1.78311 WP_000732324.1.78332 WP_000732324.1.78365 WP_000732324.1.78404 WP_000732324.1.7850 WP_000732324.1.78558 WP_000732324.1.7857 WP_000732324.1.78604 WP_000732324.1.78653 WP_000732324.1.78667 WP_000732324.1.78728 WP_000732324.1.78803 WP_000732324.1.78819 WP_000732324.1.78841 WP_000732324.1.78897 WP_000732324.1.78946 WP_000732324.1.78983 WP_000732324.1.7900 WP_000732324.1.79006 WP_000732324.1.79038 WP_000732324.1.79051 WP_000732324.1.79085 WP_000732324.1.79131 WP_000732324.1.79170 WP_000732324.1.79197 WP_000732324.1.79208 WP_000732324.1.79223 WP_000732324.1.7931 WP_000732324.1.79310 WP_000732324.1.79314 WP_000732324.1.79322 WP_000732324.1.79332 WP_000732324.1.79367 WP_000732324.1.79374 WP_000732324.1.79436 WP_000732324.1.79461 WP_000732324.1.79476 WP_000732324.1.79487 WP_000732324.1.79539 WP_000732324.1.79556 WP_000732324.1.79626 WP_000732324.1.79662 WP_000732324.1.79672 WP_000732324.1.79706 WP_000732324.1.79822 WP_000732324.1.79831 WP_000732324.1.79834 WP_000732324.1.79837 WP_000732324.1.7989 WP_000732324.1.79896 WP_000732324.1.79911 WP_000732324.1.7992 WP_000732324.1.79941 WP_000732324.1.79961 WP_000732324.1.79971 WP_000732324.1.79991 WP_000732324.1.80000 WP_000732324.1.80032 WP_000732324.1.80042 WP_000732324.1.80079 WP_000732324.1.80109 WP_000732324.1.80127 WP_000732324.1.80203 WP_000732324.1.80287 WP_000732324.1.80290 WP_000732324.1.8031 WP_000732324.1.8035 WP_000732324.1.80358 WP_000732324.1.80378 WP_000732324.1.8043 WP_000732324.1.80472 WP_000732324.1.80530 WP_000732324.1.8065 WP_000732324.1.80687 WP_000732324.1.80717 WP_000732324.1.80761 WP_000732324.1.80763 WP_000732324.1.80781 WP_000732324.1.80786 WP_000732324.1.80833 WP_000732324.1.8084 WP_000732324.1.80872 WP_000732324.1.80962 WP_000732324.1.81085 WP_000732324.1.81114 WP_000732324.1.81157 WP_000732324.1.81171 WP_000732324.1.81234 WP_000732324.1.8125 WP_000732324.1.81252 WP_000732324.1.8135 WP_000732324.1.81385 WP_000732324.1.81389 WP_000732324.1.8142 WP_000732324.1.8144 WP_000732324.1.81464 WP_000732324.1.81467 WP_000732324.1.81599 WP_000732324.1.81610 WP_000732324.1.81740 WP_000732324.1.81800 WP_000732324.1.81810 WP_000732324.1.81812 WP_000732324.1.81831 WP_000732324.1.81861 WP_000732324.1.81870 WP_000732324.1.81897 WP_000732324.1.81903 WP_000732324.1.81905 WP_000732324.1.81906 WP_000732324.1.81919 WP_000732324.1.81944 WP_000732324.1.81955 WP_000732324.1.81999 WP_000732324.1.82009 WP_000732324.1.82053 WP_000732324.1.8212 WP_000732324.1.82121 WP_000732324.1.82219 WP_000732324.1.82247 WP_000732324.1.82259 WP_000732324.1.82340 WP_000732324.1.82354 WP_000732324.1.82358 WP_000732324.1.82368 WP_000732324.1.82447 WP_000732324.1.8246 WP_000732324.1.82467 WP_000732324.1.82548 WP_000732324.1.82612 WP_000732324.1.8265 WP_000732324.1.82709 WP_000732324.1.82724 WP_000732324.1.82796 WP_000732324.1.8280 WP_000732324.1.82802 WP_000732324.1.82829 WP_000732324.1.82862 WP_000732324.1.8289 WP_000732324.1.82976 WP_000732324.1.82980 WP_000732324.1.83152 WP_000732324.1.83153 WP_000732324.1.83185 WP_000732324.1.83193 WP_000732324.1.83234 WP_000732324.1.83316 WP_000732324.1.83352 WP_000732324.1.83372 WP_000732324.1.83418 WP_000732324.1.83476 WP_000732324.1.83484 WP_000732324.1.83517 WP_000732324.1.83593 WP_000732324.1.83646 WP_000732324.1.83653 WP_000732324.1.83676 WP_000732324.1.83720 WP_000732324.1.83763 WP_000732324.1.83769 WP_000732324.1.83775 WP_000732324.1.83804 WP_000732324.1.83825 WP_000732324.1.8383 WP_000732324.1.83864 WP_000732324.1.83865 WP_000732324.1.83881 WP_000732324.1.83912 WP_000732324.1.83919 WP_000732324.1.83928 WP_000732324.1.83955 WP_000732324.1.83984 WP_000732324.1.84049 WP_000732324.1.84064 WP_000732324.1.84144 WP_000732324.1.84163 WP_000732324.1.84293 WP_000732324.1.84442 WP_000732324.1.84445 WP_000732324.1.84451 WP_000732324.1.84509 WP_000732324.1.84563 WP_000732324.1.84578 WP_000732324.1.84625 WP_000732324.1.84638 WP_000732324.1.8468 WP_000732324.1.84682 WP_000732324.1.8475 WP_000732324.1.84752 WP_000732324.1.84757 WP_000732324.1.84761 WP_000732324.1.84815 WP_000732324.1.84889 WP_000732324.1.84903 WP_000732324.1.84907 WP_000732324.1.84922 WP_000732324.1.8493 WP_000732324.1.85022 WP_000732324.1.85047 WP_000732324.1.85056 WP_000732324.1.85081 WP_000732324.1.85099 WP_000732324.1.85135 WP_000732324.1.85144 WP_000732324.1.85151 WP_000732324.1.85213 WP_000732324.1.85226 WP_000732324.1.85235 WP_000732324.1.85238 WP_000732324.1.85351 WP_000732324.1.85383 WP_000732324.1.85395 WP_000732324.1.85404 WP_000732324.1.85445 WP_000732324.1.85462 WP_000732324.1.85471 WP_000732324.1.85474 WP_000732324.1.85492 WP_000732324.1.85506 WP_000732324.1.85515 WP_000732324.1.85519 WP_000732324.1.85547 WP_000732324.1.85586 WP_000732324.1.85649 WP_000732324.1.85758 WP_000732324.1.85795 WP_000732324.1.85796 WP_000732324.1.85816 WP_000732324.1.85834 WP_000732324.1.85927 WP_000732324.1.85950 WP_000732324.1.85993 WP_000732324.1.86018 WP_000732324.1.86072 WP_000732324.1.86123 WP_000732324.1.86144 WP_000732324.1.86154 WP_000732324.1.86158 WP_000732324.1.86188 WP_000732324.1.86207 WP_000732324.1.86270 WP_000732324.1.86304 WP_000732324.1.86344 WP_000732324.1.86367 WP_000732324.1.86378 WP_000732324.1.8643 WP_000732324.1.86439 WP_000732324.1.86482 WP_000732324.1.86523 WP_000732324.1.86542 WP_000732324.1.86628 WP_000732324.1.86706 WP_000732324.1.86792 WP_000732324.1.8681 WP_000732324.1.86838 WP_000732324.1.86911 WP_000732324.1.86940 WP_000732324.1.86961 WP_000732324.1.86977 WP_000732324.1.87021 WP_000732324.1.87042 WP_000732324.1.87057 WP_000732324.1.87072 WP_000732324.1.87090 WP_000732324.1.87119 WP_000732324.1.87122 WP_000732324.1.87141 WP_000732324.1.87175 WP_000732324.1.87194 WP_000732324.1.8720 WP_000732324.1.87260 WP_000732324.1.87261 WP_000732324.1.87285 WP_000732324.1.87290 WP_000732324.1.8731 WP_000732324.1.87396 WP_000732324.1.87457 WP_000732324.1.87461 WP_000732324.1.87466 WP_000732324.1.875 WP_000732324.1.87508 WP_000732324.1.87515 WP_000732324.1.8753 WP_000732324.1.87543 WP_000732324.1.87710 WP_000732324.1.87718 WP_000732324.1.87748 WP_000732324.1.87764 WP_000732324.1.8779 WP_000732324.1.87808 WP_000732324.1.87828 WP_000732324.1.87879 WP_000732324.1.87912 WP_000732324.1.87963 WP_000732324.1.87972 WP_000732324.1.88013 WP_000732324.1.88032 WP_000732324.1.88061 WP_000732324.1.88114 WP_000732324.1.88150 WP_000732324.1.88270 WP_000732324.1.88317 WP_000732324.1.88319 WP_000732324.1.88351 WP_000732324.1.88367 WP_000732324.1.88371 WP_000732324.1.88380 WP_000732324.1.88480 WP_000732324.1.88498 WP_000732324.1.88518 WP_000732324.1.88558 WP_000732324.1.8857 WP_000732324.1.88580 WP_000732324.1.88599 WP_000732324.1.88623 WP_000732324.1.88636 WP_000732324.1.88642 WP_000732324.1.88671 WP_000732324.1.88694 WP_000732324.1.8872 WP_000732324.1.88739 WP_000732324.1.88856 WP_000732324.1.88859 WP_000732324.1.8888 WP_000732324.1.88922 WP_000732324.1.88934 WP_000732324.1.8900 WP_000732324.1.89086 WP_000732324.1.8913 WP_000732324.1.89133 WP_000732324.1.89181 WP_000732324.1.89194 WP_000732324.1.89195 WP_000732324.1.89204 WP_000732324.1.8924 WP_000732324.1.89258 WP_000732324.1.89284 WP_000732324.1.89516 WP_000732324.1.89537 WP_000732324.1.89544 WP_000732324.1.89545 WP_000732324.1.89559 WP_000732324.1.89655 WP_000732324.1.89672 WP_000732324.1.89678 WP_000732324.1.89726 WP_000732324.1.89754 WP_000732324.1.89883 WP_000732324.1.89935 WP_000732324.1.89960 WP_000732324.1.90005 WP_000732324.1.90018 WP_000732324.1.90038 WP_000732324.1.90046 WP_000732324.1.90055 WP_000732324.1.90091 WP_000732324.1.90131 WP_000732324.1.90148 WP_000732324.1.90161 WP_000732324.1.90180 WP_000732324.1.90215 WP_000732324.1.9022 WP_000732324.1.90243 WP_000732324.1.90253 WP_000732324.1.90276 WP_000732324.1.9030 WP_000732324.1.90331 WP_000732324.1.90367 WP_000732324.1.90473 WP_000732324.1.90544 WP_000732324.1.90554 WP_000732324.1.90604 WP_000732324.1.90647 WP_000732324.1.90660 WP_000732324.1.90683 WP_000732324.1.90726 WP_000732324.1.90728 WP_000732324.1.90738 WP_000732324.1.90745 WP_000732324.1.90801 WP_000732324.1.90804 WP_000732324.1.90861 WP_000732324.1.90896 WP_000732324.1.90903 WP_000732324.1.9100 WP_000732324.1.91011 WP_000732324.1.91126 WP_000732324.1.9114 WP_000732324.1.91158 WP_000732324.1.91177 WP_000732324.1.912 WP_000732324.1.91233 WP_000732324.1.91246 WP_000732324.1.91258 WP_000732324.1.91279 WP_000732324.1.91300 WP_000732324.1.91332 WP_000732324.1.91346 WP_000732324.1.91357 WP_000732324.1.91364 WP_000732324.1.91382 WP_000732324.1.9140 WP_000732324.1.91420 WP_000732324.1.91427 WP_000732324.1.91487 WP_000732324.1.91500 WP_000732324.1.91559 WP_000732324.1.91573 WP_000732324.1.91581 WP_000732324.1.91587 WP_000732324.1.91639 WP_000732324.1.91749 WP_000732324.1.91771 WP_000732324.1.91791 WP_000732324.1.91800 WP_000732324.1.91816 WP_000732324.1.91829 WP_000732324.1.91895 WP_000732324.1.91928 WP_000732324.1.91950 WP_000732324.1.92 WP_000732324.1.92133 WP_000732324.1.92140 WP_000732324.1.92164 WP_000732324.1.92169 WP_000732324.1.92173 WP_000732324.1.92185 WP_000732324.1.92196 WP_000732324.1.92227 WP_000732324.1.9224 WP_000732324.1.92253 WP_000732324.1.9234 WP_000732324.1.9239 WP_000732324.1.92436 WP_000732324.1.92442 WP_000732324.1.92497 WP_000732324.1.92500 WP_000732324.1.92520 WP_000732324.1.92534 WP_000732324.1.92565 WP_000732324.1.92607 WP_000732324.1.92679 WP_000732324.1.92691 WP_000732324.1.92723 WP_000732324.1.92735 WP_000732324.1.92741 WP_000732324.1.92773 WP_000732324.1.92789 WP_000732324.1.92805 WP_000732324.1.92862 WP_000732324.1.92864 WP_000732324.1.9293 WP_000732324.1.92950 WP_000732324.1.93074 WP_000732324.1.93125 WP_000732324.1.93163 WP_000732324.1.93176 WP_000732324.1.93191 WP_000732324.1.93224 WP_000732324.1.93300 WP_000732324.1.93336 WP_000732324.1.93416 WP_000732324.1.93438 WP_000732324.1.93444 WP_000732324.1.93514 WP_000732324.1.9352 WP_000732324.1.9354 WP_000732324.1.9358 WP_000732324.1.93590 WP_000732324.1.93658 WP_000732324.1.93678 WP_000732324.1.93710 WP_000732324.1.93722 WP_000732324.1.93738 WP_000732324.1.93769 WP_000732324.1.93787 WP_000732324.1.9387 WP_000732324.1.93882 WP_000732324.1.93883 WP_000732324.1.93891 WP_000732324.1.93976 WP_000732324.1.93981 WP_000732324.1.94074 WP_000732324.1.94082 WP_000732324.1.94087 WP_000732324.1.94096 WP_000732324.1.94119 WP_000732324.1.94165 WP_000732324.1.94172 WP_000732324.1.94293 WP_000732324.1.94294 WP_000732324.1.94335 WP_000732324.1.94340 WP_000732324.1.9437 WP_000732324.1.94374 WP_000732324.1.94375 WP_000732324.1.94376 WP_000732324.1.94389 WP_000732324.1.94414 WP_000732324.1.94530 WP_000732324.1.94550 WP_000732324.1.94576 WP_000732324.1.9464 WP_000732324.1.94688 WP_000732324.1.94733 WP_000732324.1.94741 WP_000732324.1.94789 WP_000732324.1.94797 WP_000732324.1.94844 WP_000732324.1.94845 WP_000732324.1.9485 WP_000732324.1.94857 WP_000732324.1.94866 WP_000732324.1.9497 WP_000732324.1.94980 WP_000732324.1.94989 WP_000732324.1.94999 WP_000732324.1.95038 WP_000732324.1.95077 WP_000732324.1.9510 WP_000732324.1.95120 WP_000732324.1.95327 WP_000732324.1.95342 WP_000732324.1.95361 WP_000732324.1.95372 WP_000732324.1.9538 WP_000732324.1.95537 WP_000732324.1.95581 WP_000732324.1.95603 WP_000732324.1.95639 WP_000732324.1.95681 WP_000732324.1.95699 WP_000732324.1.95704 WP_000732324.1.95713 WP_000732324.1.95714 WP_000732324.1.95737 WP_000732324.1.95760 WP_000732324.1.95806 WP_000732324.1.95877 WP_000732324.1.95885 WP_000732324.1.95914 WP_000732324.1.95918 WP_000732324.1.95986 WP_000732324.1.95997 WP_000732324.1.96014 WP_000732324.1.96030 WP_000732324.1.96056 WP_000732324.1.96057 WP_000732324.1.96067 WP_000732324.1.96075 WP_000732324.1.96135 WP_000732324.1.96148 WP_000732324.1.96228 WP_000732324.1.96255 WP_000732324.1.96283 WP_000732324.1.96297 WP_000732324.1.96312 WP_000732324.1.96314 WP_000732324.1.96322 WP_000732324.1.96334 WP_000732324.1.96433 WP_000732324.1.96472 WP_000732324.1.9650 WP_000732324.1.96535 WP_000732324.1.96538 WP_000732324.1.96554 WP_000732324.1.96566 WP_000732324.1.96591 WP_000732324.1.96603 WP_000732324.1.96678 WP_000732324.1.96699 WP_000732324.1.96705 WP_000732324.1.9675 WP_000732324.1.96780 WP_000732324.1.96836 WP_000732324.1.96855 WP_000732324.1.96859 WP_000732324.1.96922 WP_000732324.1.96965 WP_000732324.1.96969 WP_000732324.1.96985 WP_000732324.1.96997 WP_000732324.1.97000 WP_000732324.1.97014 WP_000732324.1.97029 WP_000732324.1.97034 WP_000732324.1.97141 WP_000732324.1.97161 WP_000732324.1.97164 WP_000732324.1.97205 WP_000732324.1.97228 WP_000732324.1.97230 WP_000732324.1.97241 WP_000732324.1.97312 WP_000732324.1.97336 WP_000732324.1.97348 WP_000732324.1.97352 WP_000732324.1.97355 WP_000732324.1.97367 WP_000732324.1.9737 WP_000732324.1.97392 WP_000732324.1.97427 WP_000732324.1.97450 WP_000732324.1.97456 WP_000732324.1.97494 WP_000732324.1.97530 WP_000732324.1.97531 WP_000732324.1.97537 WP_000732324.1.97576 WP_000732324.1.97585 WP_000732324.1.97664 WP_000732324.1.97687 WP_000732324.1.97696 WP_000732324.1.97699 WP_000732324.1.97744 WP_000732324.1.97746 WP_000732324.1.97762 WP_000732324.1.9788 WP_000732324.1.97935 WP_000732324.1.97955 WP_000732324.1.97974 WP_000732324.1.97997 WP_000732324.1.98054 WP_000732324.1.98058 WP_000732324.1.98161 WP_000732324.1.98174 WP_000732324.1.98179 WP_000732324.1.98195 WP_000732324.1.98233 WP_000732324.1.98248 WP_000732324.1.98249 WP_000732324.1.98281 WP_000732324.1.98328 WP_000732324.1.98352 WP_000732324.1.98353 WP_000732324.1.98366 WP_000732324.1.98387 WP_000732324.1.98409 WP_000732324.1.98425 WP_000732324.1.98585 WP_000732324.1.98609 WP_000732324.1.98659 WP_000732324.1.98667 WP_000732324.1.9872 WP_000732324.1.98723 WP_000732324.1.98730 WP_000732324.1.98734 WP_000732324.1.98741 WP_000732324.1.98750 WP_000732324.1.98786 WP_000732324.1.98821 WP_000732324.1.98842 WP_000732324.1.98880 WP_000732324.1.98883 WP_000732324.1.98894 WP_000732324.1.98978 WP_000732324.1.98985 WP_000732324.1.9910 WP_000732324.1.99136 WP_000732324.1.99207 WP_000732324.1.99283 WP_000732324.1.99308 WP_000732324.1.99414 WP_000732324.1.99418 WP_000732324.1.99509 WP_000732324.1.99523 WP_000732324.1.9965 WP_000732324.1.99683 WP_000732324.1.99849 WP_000732324.1.99859 WP_000732324.1.99884 WP_000732324.1.99954 WP_000732324.1.99955 WP_000732324.1.99984 WP_000732324.1.99999 gi|470194863|ref|YP_007581215.1| gi|470224354|ref|YP_007622933.1| gi|470192899|ref|YP_007579252.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]