SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470196184|ref|YP_007582536.1| from Staphylococcus aureus ST228/16035

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470196184|ref|YP_007582536.1|
Domain Number 1 Region: 1-198
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.05e-57
Family Phosphate binding protein-like 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470196184|ref|YP_007582536.1|
Sequence length 204
Comment ATP phosphoribosyltransferase [Staphylococcus aureus subsp. aureus ST228]
Sequence
MLRIAIAKGRLMDSLINYLDVIEYTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVE
QGMADIGIVGSDILDERQYNVNNLLNMPFGACHFAVAAKPETTNYRKIATSYVHTAETYF
KSKGIDVELIKLNGSVELACVVDMVDGIVDIVQTGTTLKANGLVEKQHISDINARLITNK
AAYFKKSQLIEQFIRSLEVSIANA
Download sequence
Identical sequences A0A0C2HYL4 A0A0E0VSJ8 A0A2K4DZA0 A5IWA6 A6QKG7 A6U564 A7X770 P64348 P64349 P64350 Q2FUT7 Q5HCL8 Q6G5Z6
gi|479330678|ref|YP_007869737.1| gi|379015795|ref|YP_005292031.1| WP_000944149.1.100049 WP_000944149.1.10006 WP_000944149.1.10014 WP_000944149.1.100171 WP_000944149.1.100180 WP_000944149.1.100184 WP_000944149.1.100235 WP_000944149.1.100265 WP_000944149.1.100272 WP_000944149.1.100298 WP_000944149.1.10032 WP_000944149.1.100347 WP_000944149.1.100366 WP_000944149.1.100391 WP_000944149.1.100399 WP_000944149.1.100452 WP_000944149.1.10046 WP_000944149.1.100464 WP_000944149.1.10050 WP_000944149.1.10053 WP_000944149.1.100534 WP_000944149.1.100535 WP_000944149.1.100562 WP_000944149.1.100582 WP_000944149.1.100596 WP_000944149.1.100678 WP_000944149.1.100693 WP_000944149.1.100699 WP_000944149.1.100704 WP_000944149.1.100719 WP_000944149.1.100726 WP_000944149.1.100823 WP_000944149.1.100832 WP_000944149.1.100860 WP_000944149.1.100888 WP_000944149.1.100934 WP_000944149.1.100963 WP_000944149.1.10097 WP_000944149.1.101002 WP_000944149.1.101019 WP_000944149.1.101027 WP_000944149.1.101055 WP_000944149.1.101058 WP_000944149.1.101068 WP_000944149.1.101071 WP_000944149.1.101072 WP_000944149.1.101103 WP_000944149.1.10111 WP_000944149.1.101142 WP_000944149.1.101160 WP_000944149.1.101192 WP_000944149.1.101217 WP_000944149.1.101266 WP_000944149.1.101298 WP_000944149.1.101329 WP_000944149.1.101330 WP_000944149.1.101352 WP_000944149.1.101379 WP_000944149.1.101406 WP_000944149.1.101414 WP_000944149.1.101441 WP_000944149.1.10148 WP_000944149.1.101495 WP_000944149.1.101531 WP_000944149.1.101566 WP_000944149.1.101567 WP_000944149.1.101570 WP_000944149.1.101598 WP_000944149.1.10165 WP_000944149.1.101661 WP_000944149.1.101670 WP_000944149.1.101691 WP_000944149.1.101704 WP_000944149.1.101725 WP_000944149.1.101728 WP_000944149.1.101745 WP_000944149.1.101778 WP_000944149.1.101788 WP_000944149.1.101813 WP_000944149.1.101820 WP_000944149.1.101821 WP_000944149.1.101825 WP_000944149.1.101852 WP_000944149.1.101902 WP_000944149.1.101906 WP_000944149.1.101943 WP_000944149.1.101950 WP_000944149.1.101999 WP_000944149.1.102065 WP_000944149.1.102066 WP_000944149.1.102084 WP_000944149.1.10209 WP_000944149.1.102096 WP_000944149.1.102123 WP_000944149.1.102126 WP_000944149.1.102130 WP_000944149.1.102132 WP_000944149.1.10238 WP_000944149.1.1025 WP_000944149.1.10274 WP_000944149.1.10308 WP_000944149.1.1031 WP_000944149.1.10343 WP_000944149.1.10358 WP_000944149.1.1043 WP_000944149.1.10436 WP_000944149.1.10469 WP_000944149.1.10478 WP_000944149.1.10481 WP_000944149.1.10526 WP_000944149.1.10543 WP_000944149.1.1060 WP_000944149.1.10617 WP_000944149.1.10624 WP_000944149.1.10644 WP_000944149.1.10707 WP_000944149.1.10749 WP_000944149.1.10751 WP_000944149.1.1077 WP_000944149.1.10785 WP_000944149.1.10823 WP_000944149.1.10841 WP_000944149.1.10843 WP_000944149.1.10858 WP_000944149.1.10919 WP_000944149.1.10942 WP_000944149.1.10976 WP_000944149.1.10979 WP_000944149.1.10985 WP_000944149.1.11001 WP_000944149.1.11069 WP_000944149.1.11073 WP_000944149.1.11083 WP_000944149.1.11084 WP_000944149.1.1115 WP_000944149.1.11162 WP_000944149.1.11188 WP_000944149.1.11220 WP_000944149.1.11223 WP_000944149.1.11228 WP_000944149.1.1124 WP_000944149.1.11261 WP_000944149.1.11281 WP_000944149.1.11282 WP_000944149.1.11286 WP_000944149.1.11287 WP_000944149.1.11322 WP_000944149.1.11333 WP_000944149.1.11377 WP_000944149.1.11378 WP_000944149.1.11403 WP_000944149.1.11407 WP_000944149.1.11447 WP_000944149.1.11451 WP_000944149.1.1147 WP_000944149.1.11475 WP_000944149.1.11492 WP_000944149.1.11504 WP_000944149.1.11513 WP_000944149.1.11556 WP_000944149.1.11571 WP_000944149.1.11611 WP_000944149.1.11640 WP_000944149.1.11646 WP_000944149.1.11660 WP_000944149.1.11663 WP_000944149.1.11665 WP_000944149.1.1171 WP_000944149.1.11730 WP_000944149.1.11736 WP_000944149.1.11741 WP_000944149.1.11768 WP_000944149.1.11781 WP_000944149.1.11795 WP_000944149.1.11837 WP_000944149.1.11884 WP_000944149.1.11903 WP_000944149.1.11919 WP_000944149.1.12005 WP_000944149.1.12019 WP_000944149.1.12042 WP_000944149.1.12098 WP_000944149.1.1210 WP_000944149.1.12137 WP_000944149.1.12149 WP_000944149.1.12152 WP_000944149.1.12170 WP_000944149.1.12175 WP_000944149.1.12181 WP_000944149.1.12234 WP_000944149.1.12256 WP_000944149.1.12330 WP_000944149.1.12366 WP_000944149.1.12436 WP_000944149.1.12437 WP_000944149.1.12508 WP_000944149.1.1252 WP_000944149.1.1257 WP_000944149.1.12598 WP_000944149.1.12605 WP_000944149.1.12608 WP_000944149.1.12618 WP_000944149.1.12685 WP_000944149.1.12705 WP_000944149.1.12707 WP_000944149.1.12733 WP_000944149.1.12737 WP_000944149.1.12770 WP_000944149.1.12780 WP_000944149.1.12788 WP_000944149.1.12802 WP_000944149.1.12829 WP_000944149.1.12858 WP_000944149.1.12862 WP_000944149.1.12884 WP_000944149.1.12904 WP_000944149.1.12918 WP_000944149.1.12920 WP_000944149.1.12938 WP_000944149.1.12951 WP_000944149.1.13062 WP_000944149.1.13112 WP_000944149.1.13154 WP_000944149.1.13164 WP_000944149.1.13169 WP_000944149.1.13170 WP_000944149.1.13189 WP_000944149.1.13243 WP_000944149.1.13250 WP_000944149.1.13326 WP_000944149.1.13355 WP_000944149.1.13366 WP_000944149.1.13376 WP_000944149.1.13379 WP_000944149.1.13405 WP_000944149.1.13448 WP_000944149.1.1347 WP_000944149.1.13514 WP_000944149.1.13554 WP_000944149.1.13612 WP_000944149.1.13665 WP_000944149.1.13668 WP_000944149.1.13670 WP_000944149.1.13728 WP_000944149.1.13870 WP_000944149.1.13879 WP_000944149.1.13884 WP_000944149.1.13897 WP_000944149.1.13914 WP_000944149.1.13933 WP_000944149.1.13948 WP_000944149.1.13983 WP_000944149.1.13986 WP_000944149.1.13987 WP_000944149.1.14025 WP_000944149.1.14071 WP_000944149.1.14097 WP_000944149.1.14143 WP_000944149.1.14163 WP_000944149.1.1418 WP_000944149.1.1420 WP_000944149.1.14201 WP_000944149.1.1425 WP_000944149.1.1429 WP_000944149.1.14298 WP_000944149.1.14305 WP_000944149.1.14337 WP_000944149.1.14342 WP_000944149.1.14349 WP_000944149.1.14358 WP_000944149.1.14363 WP_000944149.1.14366 WP_000944149.1.14394 WP_000944149.1.14397 WP_000944149.1.14412 WP_000944149.1.14535 WP_000944149.1.1457 WP_000944149.1.14577 WP_000944149.1.14596 WP_000944149.1.14639 WP_000944149.1.14665 WP_000944149.1.1468 WP_000944149.1.14681 WP_000944149.1.14696 WP_000944149.1.1471 WP_000944149.1.14729 WP_000944149.1.14734 WP_000944149.1.14747 WP_000944149.1.14770 WP_000944149.1.14774 WP_000944149.1.14825 WP_000944149.1.14846 WP_000944149.1.14868 WP_000944149.1.14888 WP_000944149.1.14967 WP_000944149.1.14970 WP_000944149.1.15000 WP_000944149.1.15015 WP_000944149.1.15029 WP_000944149.1.15071 WP_000944149.1.15091 WP_000944149.1.15098 WP_000944149.1.15108 WP_000944149.1.15150 WP_000944149.1.15173 WP_000944149.1.15185 WP_000944149.1.1520 WP_000944149.1.15201 WP_000944149.1.15206 WP_000944149.1.15241 WP_000944149.1.1525 WP_000944149.1.15255 WP_000944149.1.15268 WP_000944149.1.15269 WP_000944149.1.15294 WP_000944149.1.15296 WP_000944149.1.15329 WP_000944149.1.15421 WP_000944149.1.15524 WP_000944149.1.15532 WP_000944149.1.15533 WP_000944149.1.15544 WP_000944149.1.15546 WP_000944149.1.1558 WP_000944149.1.15590 WP_000944149.1.15591 WP_000944149.1.1564 WP_000944149.1.15679 WP_000944149.1.15691 WP_000944149.1.15722 WP_000944149.1.15753 WP_000944149.1.15785 WP_000944149.1.15812 WP_000944149.1.15819 WP_000944149.1.15888 WP_000944149.1.15892 WP_000944149.1.15897 WP_000944149.1.159 WP_000944149.1.15920 WP_000944149.1.15921 WP_000944149.1.15925 WP_000944149.1.15948 WP_000944149.1.16018 WP_000944149.1.16068 WP_000944149.1.16096 WP_000944149.1.16098 WP_000944149.1.16140 WP_000944149.1.16157 WP_000944149.1.16195 WP_000944149.1.16203 WP_000944149.1.16223 WP_000944149.1.1623 WP_000944149.1.16237 WP_000944149.1.16251 WP_000944149.1.16265 WP_000944149.1.16276 WP_000944149.1.16311 WP_000944149.1.16395 WP_000944149.1.16399 WP_000944149.1.16407 WP_000944149.1.16417 WP_000944149.1.16436 WP_000944149.1.16478 WP_000944149.1.16569 WP_000944149.1.16589 WP_000944149.1.16632 WP_000944149.1.16639 WP_000944149.1.1665 WP_000944149.1.16651 WP_000944149.1.16653 WP_000944149.1.16672 WP_000944149.1.16688 WP_000944149.1.16693 WP_000944149.1.16747 WP_000944149.1.16761 WP_000944149.1.16794 WP_000944149.1.16815 WP_000944149.1.16824 WP_000944149.1.16880 WP_000944149.1.16882 WP_000944149.1.16920 WP_000944149.1.16925 WP_000944149.1.16946 WP_000944149.1.16969 WP_000944149.1.170 WP_000944149.1.17009 WP_000944149.1.17012 WP_000944149.1.17046 WP_000944149.1.17050 WP_000944149.1.17080 WP_000944149.1.17122 WP_000944149.1.17132 WP_000944149.1.17139 WP_000944149.1.17143 WP_000944149.1.17157 WP_000944149.1.17169 WP_000944149.1.17176 WP_000944149.1.17180 WP_000944149.1.17201 WP_000944149.1.17210 WP_000944149.1.17240 WP_000944149.1.1729 WP_000944149.1.17309 WP_000944149.1.17327 WP_000944149.1.1736 WP_000944149.1.1741 WP_000944149.1.17419 WP_000944149.1.17454 WP_000944149.1.17529 WP_000944149.1.17531 WP_000944149.1.1756 WP_000944149.1.17569 WP_000944149.1.17590 WP_000944149.1.17643 WP_000944149.1.1765 WP_000944149.1.17657 WP_000944149.1.17671 WP_000944149.1.17717 WP_000944149.1.17718 WP_000944149.1.17725 WP_000944149.1.17737 WP_000944149.1.17796 WP_000944149.1.17818 WP_000944149.1.17832 WP_000944149.1.17847 WP_000944149.1.17853 WP_000944149.1.17909 WP_000944149.1.17922 WP_000944149.1.17928 WP_000944149.1.17943 WP_000944149.1.17974 WP_000944149.1.17987 WP_000944149.1.18011 WP_000944149.1.18043 WP_000944149.1.18069 WP_000944149.1.18080 WP_000944149.1.18105 WP_000944149.1.18113 WP_000944149.1.18140 WP_000944149.1.18153 WP_000944149.1.18203 WP_000944149.1.18237 WP_000944149.1.18248 WP_000944149.1.18261 WP_000944149.1.18283 WP_000944149.1.18288 WP_000944149.1.1829 WP_000944149.1.18301 WP_000944149.1.18309 WP_000944149.1.18310 WP_000944149.1.18320 WP_000944149.1.1835 WP_000944149.1.18360 WP_000944149.1.18412 WP_000944149.1.18429 WP_000944149.1.1847 WP_000944149.1.18487 WP_000944149.1.18495 WP_000944149.1.18506 WP_000944149.1.18507 WP_000944149.1.18516 WP_000944149.1.18539 WP_000944149.1.18560 WP_000944149.1.18567 WP_000944149.1.18570 WP_000944149.1.18591 WP_000944149.1.18632 WP_000944149.1.18656 WP_000944149.1.18679 WP_000944149.1.18719 WP_000944149.1.18741 WP_000944149.1.18777 WP_000944149.1.18792 WP_000944149.1.18818 WP_000944149.1.18819 WP_000944149.1.18830 WP_000944149.1.18834 WP_000944149.1.18836 WP_000944149.1.18882 WP_000944149.1.1892 WP_000944149.1.18963 WP_000944149.1.18965 WP_000944149.1.18974 WP_000944149.1.18996 WP_000944149.1.19014 WP_000944149.1.19022 WP_000944149.1.19052 WP_000944149.1.19082 WP_000944149.1.19102 WP_000944149.1.19109 WP_000944149.1.1911 WP_000944149.1.1921 WP_000944149.1.19301 WP_000944149.1.19306 WP_000944149.1.19322 WP_000944149.1.19375 WP_000944149.1.19377 WP_000944149.1.19411 WP_000944149.1.1943 WP_000944149.1.19430 WP_000944149.1.19450 WP_000944149.1.19537 WP_000944149.1.19555 WP_000944149.1.19577 WP_000944149.1.19611 WP_000944149.1.1962 WP_000944149.1.1964 WP_000944149.1.19643 WP_000944149.1.19653 WP_000944149.1.19700 WP_000944149.1.19701 WP_000944149.1.19725 WP_000944149.1.19732 WP_000944149.1.1974 WP_000944149.1.19748 WP_000944149.1.1975 WP_000944149.1.19759 WP_000944149.1.19765 WP_000944149.1.19792 WP_000944149.1.19816 WP_000944149.1.19848 WP_000944149.1.19881 WP_000944149.1.19891 WP_000944149.1.19912 WP_000944149.1.19921 WP_000944149.1.19977 WP_000944149.1.19980 WP_000944149.1.19981 WP_000944149.1.19982 WP_000944149.1.20006 WP_000944149.1.20049 WP_000944149.1.20052 WP_000944149.1.2007 WP_000944149.1.20078 WP_000944149.1.20090 WP_000944149.1.20100 WP_000944149.1.20155 WP_000944149.1.20156 WP_000944149.1.20161 WP_000944149.1.20167 WP_000944149.1.20191 WP_000944149.1.20210 WP_000944149.1.20214 WP_000944149.1.20245 WP_000944149.1.2029 WP_000944149.1.20324 WP_000944149.1.20340 WP_000944149.1.20394 WP_000944149.1.20398 WP_000944149.1.20399 WP_000944149.1.20411 WP_000944149.1.20447 WP_000944149.1.20479 WP_000944149.1.20487 WP_000944149.1.20558 WP_000944149.1.20574 WP_000944149.1.20585 WP_000944149.1.20611 WP_000944149.1.20619 WP_000944149.1.20620 WP_000944149.1.20690 WP_000944149.1.20736 WP_000944149.1.20796 WP_000944149.1.20821 WP_000944149.1.20846 WP_000944149.1.20867 WP_000944149.1.20878 WP_000944149.1.20913 WP_000944149.1.20922 WP_000944149.1.20935 WP_000944149.1.20939 WP_000944149.1.20945 WP_000944149.1.20971 WP_000944149.1.20979 WP_000944149.1.21009 WP_000944149.1.21056 WP_000944149.1.21064 WP_000944149.1.21066 WP_000944149.1.21078 WP_000944149.1.21102 WP_000944149.1.21109 WP_000944149.1.21111 WP_000944149.1.21154 WP_000944149.1.21183 WP_000944149.1.2119 WP_000944149.1.21257 WP_000944149.1.21272 WP_000944149.1.2129 WP_000944149.1.21313 WP_000944149.1.21339 WP_000944149.1.2135 WP_000944149.1.21359 WP_000944149.1.21375 WP_000944149.1.21379 WP_000944149.1.21393 WP_000944149.1.21412 WP_000944149.1.21449 WP_000944149.1.21464 WP_000944149.1.21465 WP_000944149.1.21480 WP_000944149.1.21500 WP_000944149.1.21511 WP_000944149.1.21514 WP_000944149.1.21572 WP_000944149.1.2159 WP_000944149.1.2160 WP_000944149.1.21636 WP_000944149.1.21724 WP_000944149.1.21746 WP_000944149.1.21763 WP_000944149.1.21787 WP_000944149.1.21830 WP_000944149.1.21894 WP_000944149.1.21954 WP_000944149.1.21988 WP_000944149.1.22022 WP_000944149.1.22027 WP_000944149.1.22045 WP_000944149.1.22082 WP_000944149.1.22093 WP_000944149.1.2211 WP_000944149.1.22111 WP_000944149.1.22177 WP_000944149.1.22197 WP_000944149.1.22200 WP_000944149.1.22227 WP_000944149.1.22259 WP_000944149.1.22302 WP_000944149.1.22400 WP_000944149.1.22418 WP_000944149.1.22493 WP_000944149.1.22533 WP_000944149.1.22559 WP_000944149.1.22650 WP_000944149.1.22696 WP_000944149.1.22702 WP_000944149.1.22709 WP_000944149.1.22727 WP_000944149.1.22730 WP_000944149.1.22731 WP_000944149.1.22738 WP_000944149.1.22739 WP_000944149.1.22789 WP_000944149.1.22790 WP_000944149.1.22792 WP_000944149.1.22803 WP_000944149.1.22843 WP_000944149.1.22853 WP_000944149.1.22859 WP_000944149.1.22869 WP_000944149.1.22890 WP_000944149.1.22969 WP_000944149.1.22975 WP_000944149.1.23008 WP_000944149.1.23061 WP_000944149.1.23069 WP_000944149.1.23082 WP_000944149.1.23103 WP_000944149.1.23121 WP_000944149.1.23130 WP_000944149.1.23132 WP_000944149.1.23133 WP_000944149.1.23161 WP_000944149.1.23185 WP_000944149.1.23197 WP_000944149.1.23217 WP_000944149.1.23228 WP_000944149.1.23238 WP_000944149.1.23244 WP_000944149.1.2327 WP_000944149.1.23275 WP_000944149.1.23288 WP_000944149.1.23413 WP_000944149.1.23449 WP_000944149.1.23516 WP_000944149.1.23531 WP_000944149.1.23568 WP_000944149.1.23572 WP_000944149.1.23630 WP_000944149.1.23644 WP_000944149.1.23690 WP_000944149.1.23740 WP_000944149.1.23796 WP_000944149.1.2382 WP_000944149.1.23842 WP_000944149.1.23856 WP_000944149.1.2389 WP_000944149.1.23896 WP_000944149.1.23900 WP_000944149.1.23956 WP_000944149.1.23972 WP_000944149.1.23995 WP_000944149.1.24000 WP_000944149.1.24129 WP_000944149.1.24148 WP_000944149.1.24174 WP_000944149.1.2420 WP_000944149.1.24207 WP_000944149.1.24213 WP_000944149.1.24263 WP_000944149.1.2427 WP_000944149.1.24275 WP_000944149.1.24277 WP_000944149.1.2434 WP_000944149.1.24416 WP_000944149.1.24436 WP_000944149.1.24437 WP_000944149.1.24439 WP_000944149.1.24469 WP_000944149.1.2450 WP_000944149.1.24503 WP_000944149.1.2458 WP_000944149.1.24589 WP_000944149.1.24596 WP_000944149.1.24602 WP_000944149.1.24631 WP_000944149.1.24679 WP_000944149.1.24684 WP_000944149.1.24702 WP_000944149.1.24823 WP_000944149.1.24855 WP_000944149.1.24903 WP_000944149.1.2497 WP_000944149.1.25007 WP_000944149.1.2501 WP_000944149.1.25012 WP_000944149.1.25029 WP_000944149.1.2506 WP_000944149.1.25070 WP_000944149.1.25092 WP_000944149.1.25098 WP_000944149.1.25115 WP_000944149.1.25120 WP_000944149.1.25145 WP_000944149.1.25167 WP_000944149.1.25209 WP_000944149.1.2522 WP_000944149.1.25287 WP_000944149.1.25331 WP_000944149.1.25361 WP_000944149.1.25459 WP_000944149.1.25479 WP_000944149.1.25489 WP_000944149.1.2552 WP_000944149.1.25557 WP_000944149.1.25593 WP_000944149.1.25595 WP_000944149.1.25621 WP_000944149.1.25623 WP_000944149.1.257 WP_000944149.1.25721 WP_000944149.1.25737 WP_000944149.1.25758 WP_000944149.1.25772 WP_000944149.1.25776 WP_000944149.1.25779 WP_000944149.1.2579 WP_000944149.1.25801 WP_000944149.1.25802 WP_000944149.1.25840 WP_000944149.1.25852 WP_000944149.1.25856 WP_000944149.1.25857 WP_000944149.1.25891 WP_000944149.1.2590 WP_000944149.1.25910 WP_000944149.1.25930 WP_000944149.1.25984 WP_000944149.1.26015 WP_000944149.1.26033 WP_000944149.1.26039 WP_000944149.1.2608 WP_000944149.1.26086 WP_000944149.1.26106 WP_000944149.1.26143 WP_000944149.1.26169 WP_000944149.1.26172 WP_000944149.1.2619 WP_000944149.1.262 WP_000944149.1.2621 WP_000944149.1.26255 WP_000944149.1.26266 WP_000944149.1.26276 WP_000944149.1.26289 WP_000944149.1.26290 WP_000944149.1.26298 WP_000944149.1.26307 WP_000944149.1.26314 WP_000944149.1.26318 WP_000944149.1.2633 WP_000944149.1.26340 WP_000944149.1.26345 WP_000944149.1.26354 WP_000944149.1.26359 WP_000944149.1.26364 WP_000944149.1.26397 WP_000944149.1.26399 WP_000944149.1.26404 WP_000944149.1.26405 WP_000944149.1.2643 WP_000944149.1.2645 WP_000944149.1.26506 WP_000944149.1.2658 WP_000944149.1.26584 WP_000944149.1.26626 WP_000944149.1.2664 WP_000944149.1.26662 WP_000944149.1.26677 WP_000944149.1.26692 WP_000944149.1.2673 WP_000944149.1.26749 WP_000944149.1.26751 WP_000944149.1.26772 WP_000944149.1.26790 WP_000944149.1.26804 WP_000944149.1.2684 WP_000944149.1.26840 WP_000944149.1.26850 WP_000944149.1.26865 WP_000944149.1.2687 WP_000944149.1.26884 WP_000944149.1.2689 WP_000944149.1.26903 WP_000944149.1.26905 WP_000944149.1.26929 WP_000944149.1.26938 WP_000944149.1.26944 WP_000944149.1.26963 WP_000944149.1.2697 WP_000944149.1.27013 WP_000944149.1.27053 WP_000944149.1.27080 WP_000944149.1.27083 WP_000944149.1.27166 WP_000944149.1.27168 WP_000944149.1.27170 WP_000944149.1.27182 WP_000944149.1.2719 WP_000944149.1.27262 WP_000944149.1.27293 WP_000944149.1.27294 WP_000944149.1.27323 WP_000944149.1.27379 WP_000944149.1.27387 WP_000944149.1.27447 WP_000944149.1.27448 WP_000944149.1.27456 WP_000944149.1.27467 WP_000944149.1.27468 WP_000944149.1.2753 WP_000944149.1.27539 WP_000944149.1.27590 WP_000944149.1.27615 WP_000944149.1.27646 WP_000944149.1.27689 WP_000944149.1.27696 WP_000944149.1.27739 WP_000944149.1.27744 WP_000944149.1.27765 WP_000944149.1.27793 WP_000944149.1.27799 WP_000944149.1.27817 WP_000944149.1.27830 WP_000944149.1.27929 WP_000944149.1.2795 WP_000944149.1.27950 WP_000944149.1.28016 WP_000944149.1.28079 WP_000944149.1.28091 WP_000944149.1.28105 WP_000944149.1.28173 WP_000944149.1.28213 WP_000944149.1.28230 WP_000944149.1.28253 WP_000944149.1.28257 WP_000944149.1.28274 WP_000944149.1.28315 WP_000944149.1.28319 WP_000944149.1.28334 WP_000944149.1.28347 WP_000944149.1.28358 WP_000944149.1.28399 WP_000944149.1.28400 WP_000944149.1.28430 WP_000944149.1.28447 WP_000944149.1.28482 WP_000944149.1.2852 WP_000944149.1.28564 WP_000944149.1.28578 WP_000944149.1.28580 WP_000944149.1.28584 WP_000944149.1.28605 WP_000944149.1.28614 WP_000944149.1.2862 WP_000944149.1.28710 WP_000944149.1.28720 WP_000944149.1.28763 WP_000944149.1.28784 WP_000944149.1.28785 WP_000944149.1.28848 WP_000944149.1.28866 WP_000944149.1.28871 WP_000944149.1.28909 WP_000944149.1.2891 WP_000944149.1.28915 WP_000944149.1.28981 WP_000944149.1.28987 WP_000944149.1.29014 WP_000944149.1.29052 WP_000944149.1.29060 WP_000944149.1.29107 WP_000944149.1.29112 WP_000944149.1.2913 WP_000944149.1.29155 WP_000944149.1.29166 WP_000944149.1.29187 WP_000944149.1.29226 WP_000944149.1.29242 WP_000944149.1.29243 WP_000944149.1.29244 WP_000944149.1.29263 WP_000944149.1.29272 WP_000944149.1.29276 WP_000944149.1.29301 WP_000944149.1.29312 WP_000944149.1.29315 WP_000944149.1.29329 WP_000944149.1.29366 WP_000944149.1.29368 WP_000944149.1.29395 WP_000944149.1.29420 WP_000944149.1.29468 WP_000944149.1.29511 WP_000944149.1.29522 WP_000944149.1.29553 WP_000944149.1.2957 WP_000944149.1.29716 WP_000944149.1.2972 WP_000944149.1.29731 WP_000944149.1.29736 WP_000944149.1.29744 WP_000944149.1.2975 WP_000944149.1.29788 WP_000944149.1.2981 WP_000944149.1.2983 WP_000944149.1.29862 WP_000944149.1.29902 WP_000944149.1.29905 WP_000944149.1.29918 WP_000944149.1.29956 WP_000944149.1.2997 WP_000944149.1.29981 WP_000944149.1.29982 WP_000944149.1.30012 WP_000944149.1.30023 WP_000944149.1.30047 WP_000944149.1.30051 WP_000944149.1.30057 WP_000944149.1.30089 WP_000944149.1.30095 WP_000944149.1.30100 WP_000944149.1.30130 WP_000944149.1.30191 WP_000944149.1.30197 WP_000944149.1.30204 WP_000944149.1.30209 WP_000944149.1.30249 WP_000944149.1.30268 WP_000944149.1.30302 WP_000944149.1.30307 WP_000944149.1.30333 WP_000944149.1.30364 WP_000944149.1.30381 WP_000944149.1.30385 WP_000944149.1.30422 WP_000944149.1.30496 WP_000944149.1.30508 WP_000944149.1.30531 WP_000944149.1.30560 WP_000944149.1.30566 WP_000944149.1.30568 WP_000944149.1.30622 WP_000944149.1.30645 WP_000944149.1.30646 WP_000944149.1.30648 WP_000944149.1.30650 WP_000944149.1.30652 WP_000944149.1.30666 WP_000944149.1.30702 WP_000944149.1.30720 WP_000944149.1.30726 WP_000944149.1.30763 WP_000944149.1.3077 WP_000944149.1.30845 WP_000944149.1.30847 WP_000944149.1.30854 WP_000944149.1.30880 WP_000944149.1.30889 WP_000944149.1.30907 WP_000944149.1.30928 WP_000944149.1.30998 WP_000944149.1.31005 WP_000944149.1.31022 WP_000944149.1.31039 WP_000944149.1.31041 WP_000944149.1.31048 WP_000944149.1.31065 WP_000944149.1.31068 WP_000944149.1.31077 WP_000944149.1.31113 WP_000944149.1.31176 WP_000944149.1.31194 WP_000944149.1.31206 WP_000944149.1.31212 WP_000944149.1.3123 WP_000944149.1.31278 WP_000944149.1.31315 WP_000944149.1.31337 WP_000944149.1.31339 WP_000944149.1.31355 WP_000944149.1.31426 WP_000944149.1.31437 WP_000944149.1.31441 WP_000944149.1.31442 WP_000944149.1.31462 WP_000944149.1.31468 WP_000944149.1.31479 WP_000944149.1.31497 WP_000944149.1.31505 WP_000944149.1.31529 WP_000944149.1.31539 WP_000944149.1.31568 WP_000944149.1.31589 WP_000944149.1.31605 WP_000944149.1.31642 WP_000944149.1.31647 WP_000944149.1.31653 WP_000944149.1.31686 WP_000944149.1.31743 WP_000944149.1.31753 WP_000944149.1.31791 WP_000944149.1.31827 WP_000944149.1.31828 WP_000944149.1.31842 WP_000944149.1.3188 WP_000944149.1.31892 WP_000944149.1.31931 WP_000944149.1.31949 WP_000944149.1.31997 WP_000944149.1.32003 WP_000944149.1.32029 WP_000944149.1.32059 WP_000944149.1.32067 WP_000944149.1.32077 WP_000944149.1.32125 WP_000944149.1.32130 WP_000944149.1.32160 WP_000944149.1.32207 WP_000944149.1.3229 WP_000944149.1.3231 WP_000944149.1.32339 WP_000944149.1.32405 WP_000944149.1.3242 WP_000944149.1.32474 WP_000944149.1.32481 WP_000944149.1.32483 WP_000944149.1.32514 WP_000944149.1.32565 WP_000944149.1.32599 WP_000944149.1.32607 WP_000944149.1.32634 WP_000944149.1.32645 WP_000944149.1.32739 WP_000944149.1.32746 WP_000944149.1.32761 WP_000944149.1.32763 WP_000944149.1.32764 WP_000944149.1.32770 WP_000944149.1.32800 WP_000944149.1.32829 WP_000944149.1.32839 WP_000944149.1.32928 WP_000944149.1.32939 WP_000944149.1.32954 WP_000944149.1.33029 WP_000944149.1.33038 WP_000944149.1.33048 WP_000944149.1.33110 WP_000944149.1.33123 WP_000944149.1.33138 WP_000944149.1.33212 WP_000944149.1.33250 WP_000944149.1.33252 WP_000944149.1.33266 WP_000944149.1.33296 WP_000944149.1.3330 WP_000944149.1.33307 WP_000944149.1.33322 WP_000944149.1.33328 WP_000944149.1.33335 WP_000944149.1.33350 WP_000944149.1.33357 WP_000944149.1.3338 WP_000944149.1.33416 WP_000944149.1.3342 WP_000944149.1.3343 WP_000944149.1.33432 WP_000944149.1.3345 WP_000944149.1.33463 WP_000944149.1.33468 WP_000944149.1.3347 WP_000944149.1.33507 WP_000944149.1.33520 WP_000944149.1.33538 WP_000944149.1.33567 WP_000944149.1.33594 WP_000944149.1.33607 WP_000944149.1.33626 WP_000944149.1.33627 WP_000944149.1.3363 WP_000944149.1.33654 WP_000944149.1.33655 WP_000944149.1.33692 WP_000944149.1.33695 WP_000944149.1.33707 WP_000944149.1.33718 WP_000944149.1.33735 WP_000944149.1.33743 WP_000944149.1.33756 WP_000944149.1.33765 WP_000944149.1.33766 WP_000944149.1.33767 WP_000944149.1.33769 WP_000944149.1.33792 WP_000944149.1.33804 WP_000944149.1.33813 WP_000944149.1.33816 WP_000944149.1.33850 WP_000944149.1.33940 WP_000944149.1.33949 WP_000944149.1.33963 WP_000944149.1.33968 WP_000944149.1.33971 WP_000944149.1.33983 WP_000944149.1.33989 WP_000944149.1.33994 WP_000944149.1.34026 WP_000944149.1.34030 WP_000944149.1.34051 WP_000944149.1.34060 WP_000944149.1.34062 WP_000944149.1.34069 WP_000944149.1.34078 WP_000944149.1.34100 WP_000944149.1.34112 WP_000944149.1.34132 WP_000944149.1.34168 WP_000944149.1.34182 WP_000944149.1.34194 WP_000944149.1.34209 WP_000944149.1.34223 WP_000944149.1.34244 WP_000944149.1.34250 WP_000944149.1.34251 WP_000944149.1.34254 WP_000944149.1.34285 WP_000944149.1.34334 WP_000944149.1.34381 WP_000944149.1.34403 WP_000944149.1.34410 WP_000944149.1.34427 WP_000944149.1.34436 WP_000944149.1.34471 WP_000944149.1.34473 WP_000944149.1.34482 WP_000944149.1.34492 WP_000944149.1.34502 WP_000944149.1.34510 WP_000944149.1.34512 WP_000944149.1.34526 WP_000944149.1.34531 WP_000944149.1.34569 WP_000944149.1.3461 WP_000944149.1.34620 WP_000944149.1.34677 WP_000944149.1.34723 WP_000944149.1.34733 WP_000944149.1.34737 WP_000944149.1.34767 WP_000944149.1.34774 WP_000944149.1.34818 WP_000944149.1.34890 WP_000944149.1.34912 WP_000944149.1.34918 WP_000944149.1.34923 WP_000944149.1.34943 WP_000944149.1.34998 WP_000944149.1.35054 WP_000944149.1.35059 WP_000944149.1.35062 WP_000944149.1.35089 WP_000944149.1.35097 WP_000944149.1.35110 WP_000944149.1.35121 WP_000944149.1.35182 WP_000944149.1.35194 WP_000944149.1.35233 WP_000944149.1.35276 WP_000944149.1.35285 WP_000944149.1.35297 WP_000944149.1.35334 WP_000944149.1.35342 WP_000944149.1.354 WP_000944149.1.35415 WP_000944149.1.35423 WP_000944149.1.3547 WP_000944149.1.3549 WP_000944149.1.35498 WP_000944149.1.35506 WP_000944149.1.35519 WP_000944149.1.35525 WP_000944149.1.35580 WP_000944149.1.35615 WP_000944149.1.35623 WP_000944149.1.35659 WP_000944149.1.35673 WP_000944149.1.35686 WP_000944149.1.3569 WP_000944149.1.35696 WP_000944149.1.35730 WP_000944149.1.3574 WP_000944149.1.35742 WP_000944149.1.35801 WP_000944149.1.35826 WP_000944149.1.35900 WP_000944149.1.35903 WP_000944149.1.35928 WP_000944149.1.35950 WP_000944149.1.35958 WP_000944149.1.36004 WP_000944149.1.36041 WP_000944149.1.36082 WP_000944149.1.36102 WP_000944149.1.3611 WP_000944149.1.36119 WP_000944149.1.36141 WP_000944149.1.3617 WP_000944149.1.36176 WP_000944149.1.36187 WP_000944149.1.36188 WP_000944149.1.36208 WP_000944149.1.36250 WP_000944149.1.36264 WP_000944149.1.36278 WP_000944149.1.36282 WP_000944149.1.36307 WP_000944149.1.36344 WP_000944149.1.36389 WP_000944149.1.36532 WP_000944149.1.36535 WP_000944149.1.3655 WP_000944149.1.36570 WP_000944149.1.36580 WP_000944149.1.36600 WP_000944149.1.36615 WP_000944149.1.3666 WP_000944149.1.36669 WP_000944149.1.36689 WP_000944149.1.36697 WP_000944149.1.36698 WP_000944149.1.36745 WP_000944149.1.3675 WP_000944149.1.36754 WP_000944149.1.36773 WP_000944149.1.36783 WP_000944149.1.36793 WP_000944149.1.36796 WP_000944149.1.36797 WP_000944149.1.36822 WP_000944149.1.3685 WP_000944149.1.3687 WP_000944149.1.3690 WP_000944149.1.36916 WP_000944149.1.36932 WP_000944149.1.36955 WP_000944149.1.36962 WP_000944149.1.36979 WP_000944149.1.36980 WP_000944149.1.36997 WP_000944149.1.37002 WP_000944149.1.37016 WP_000944149.1.3703 WP_000944149.1.37044 WP_000944149.1.37045 WP_000944149.1.37055 WP_000944149.1.37080 WP_000944149.1.37091 WP_000944149.1.37121 WP_000944149.1.37134 WP_000944149.1.37145 WP_000944149.1.3718 WP_000944149.1.3719 WP_000944149.1.37220 WP_000944149.1.37240 WP_000944149.1.37341 WP_000944149.1.37378 WP_000944149.1.37398 WP_000944149.1.37424 WP_000944149.1.37453 WP_000944149.1.37467 WP_000944149.1.37583 WP_000944149.1.37602 WP_000944149.1.37605 WP_000944149.1.37606 WP_000944149.1.37621 WP_000944149.1.37624 WP_000944149.1.3774 WP_000944149.1.3776 WP_000944149.1.37781 WP_000944149.1.37788 WP_000944149.1.37815 WP_000944149.1.37828 WP_000944149.1.37866 WP_000944149.1.37875 WP_000944149.1.37891 WP_000944149.1.37907 WP_000944149.1.37953 WP_000944149.1.37987 WP_000944149.1.38020 WP_000944149.1.38030 WP_000944149.1.38034 WP_000944149.1.38038 WP_000944149.1.38057 WP_000944149.1.38070 WP_000944149.1.38082 WP_000944149.1.3809 WP_000944149.1.38100 WP_000944149.1.3813 WP_000944149.1.38160 WP_000944149.1.3817 WP_000944149.1.38177 WP_000944149.1.3820 WP_000944149.1.38230 WP_000944149.1.38232 WP_000944149.1.38276 WP_000944149.1.38282 WP_000944149.1.38304 WP_000944149.1.38309 WP_000944149.1.38316 WP_000944149.1.38339 WP_000944149.1.38383 WP_000944149.1.38390 WP_000944149.1.3842 WP_000944149.1.38437 WP_000944149.1.38453 WP_000944149.1.38493 WP_000944149.1.38516 WP_000944149.1.38522 WP_000944149.1.38546 WP_000944149.1.38557 WP_000944149.1.38607 WP_000944149.1.38612 WP_000944149.1.3867 WP_000944149.1.38674 WP_000944149.1.38721 WP_000944149.1.3875 WP_000944149.1.38760 WP_000944149.1.38786 WP_000944149.1.38823 WP_000944149.1.38841 WP_000944149.1.38858 WP_000944149.1.38862 WP_000944149.1.38926 WP_000944149.1.38931 WP_000944149.1.38940 WP_000944149.1.38941 WP_000944149.1.38943 WP_000944149.1.38960 WP_000944149.1.38972 WP_000944149.1.38979 WP_000944149.1.38985 WP_000944149.1.38989 WP_000944149.1.390 WP_000944149.1.39012 WP_000944149.1.39014 WP_000944149.1.39043 WP_000944149.1.39053 WP_000944149.1.3906 WP_000944149.1.3908 WP_000944149.1.391 WP_000944149.1.39108 WP_000944149.1.39126 WP_000944149.1.39203 WP_000944149.1.39206 WP_000944149.1.39217 WP_000944149.1.39241 WP_000944149.1.3926 WP_000944149.1.39272 WP_000944149.1.39285 WP_000944149.1.39290 WP_000944149.1.39332 WP_000944149.1.39333 WP_000944149.1.39378 WP_000944149.1.39397 WP_000944149.1.39406 WP_000944149.1.39486 WP_000944149.1.39506 WP_000944149.1.39519 WP_000944149.1.39527 WP_000944149.1.39550 WP_000944149.1.39613 WP_000944149.1.39645 WP_000944149.1.39682 WP_000944149.1.39687 WP_000944149.1.39689 WP_000944149.1.39697 WP_000944149.1.39711 WP_000944149.1.39738 WP_000944149.1.39767 WP_000944149.1.39789 WP_000944149.1.39832 WP_000944149.1.39838 WP_000944149.1.39856 WP_000944149.1.39869 WP_000944149.1.39943 WP_000944149.1.40014 WP_000944149.1.40043 WP_000944149.1.40099 WP_000944149.1.4010 WP_000944149.1.40120 WP_000944149.1.40137 WP_000944149.1.40161 WP_000944149.1.40164 WP_000944149.1.40173 WP_000944149.1.4019 WP_000944149.1.40318 WP_000944149.1.40320 WP_000944149.1.40329 WP_000944149.1.40330 WP_000944149.1.40342 WP_000944149.1.40368 WP_000944149.1.40383 WP_000944149.1.40401 WP_000944149.1.40406 WP_000944149.1.40409 WP_000944149.1.4045 WP_000944149.1.40474 WP_000944149.1.40481 WP_000944149.1.40505 WP_000944149.1.40531 WP_000944149.1.40532 WP_000944149.1.40554 WP_000944149.1.4056 WP_000944149.1.40579 WP_000944149.1.40588 WP_000944149.1.40613 WP_000944149.1.40620 WP_000944149.1.40644 WP_000944149.1.40655 WP_000944149.1.40658 WP_000944149.1.40659 WP_000944149.1.40748 WP_000944149.1.40760 WP_000944149.1.4078 WP_000944149.1.40780 WP_000944149.1.40797 WP_000944149.1.40800 WP_000944149.1.40814 WP_000944149.1.40816 WP_000944149.1.41011 WP_000944149.1.4102 WP_000944149.1.41038 WP_000944149.1.41058 WP_000944149.1.41064 WP_000944149.1.41084 WP_000944149.1.41094 WP_000944149.1.41104 WP_000944149.1.41119 WP_000944149.1.41122 WP_000944149.1.41129 WP_000944149.1.41133 WP_000944149.1.4115 WP_000944149.1.41178 WP_000944149.1.412 WP_000944149.1.41208 WP_000944149.1.41241 WP_000944149.1.41255 WP_000944149.1.41289 WP_000944149.1.4129 WP_000944149.1.41350 WP_000944149.1.41389 WP_000944149.1.41426 WP_000944149.1.41432 WP_000944149.1.41433 WP_000944149.1.4144 WP_000944149.1.41473 WP_000944149.1.41499 WP_000944149.1.41532 WP_000944149.1.41533 WP_000944149.1.41558 WP_000944149.1.41567 WP_000944149.1.41582 WP_000944149.1.41587 WP_000944149.1.41612 WP_000944149.1.41623 WP_000944149.1.41674 WP_000944149.1.41796 WP_000944149.1.41817 WP_000944149.1.41839 WP_000944149.1.4188 WP_000944149.1.41891 WP_000944149.1.41898 WP_000944149.1.41935 WP_000944149.1.41943 WP_000944149.1.41989 WP_000944149.1.420 WP_000944149.1.42001 WP_000944149.1.42003 WP_000944149.1.42015 WP_000944149.1.42017 WP_000944149.1.42028 WP_000944149.1.42064 WP_000944149.1.42085 WP_000944149.1.42087 WP_000944149.1.42125 WP_000944149.1.42169 WP_000944149.1.42198 WP_000944149.1.42269 WP_000944149.1.42305 WP_000944149.1.42355 WP_000944149.1.42403 WP_000944149.1.42436 WP_000944149.1.42459 WP_000944149.1.42460 WP_000944149.1.42481 WP_000944149.1.42510 WP_000944149.1.42551 WP_000944149.1.42593 WP_000944149.1.426 WP_000944149.1.42640 WP_000944149.1.42652 WP_000944149.1.42668 WP_000944149.1.42674 WP_000944149.1.42737 WP_000944149.1.42738 WP_000944149.1.42740 WP_000944149.1.42759 WP_000944149.1.42764 WP_000944149.1.42786 WP_000944149.1.42798 WP_000944149.1.42819 WP_000944149.1.42837 WP_000944149.1.42848 WP_000944149.1.42883 WP_000944149.1.42897 WP_000944149.1.4293 WP_000944149.1.42985 WP_000944149.1.4299 WP_000944149.1.42990 WP_000944149.1.43014 WP_000944149.1.43020 WP_000944149.1.43047 WP_000944149.1.43072 WP_000944149.1.43114 WP_000944149.1.43122 WP_000944149.1.43131 WP_000944149.1.43134 WP_000944149.1.43143 WP_000944149.1.43147 WP_000944149.1.43159 WP_000944149.1.43165 WP_000944149.1.43179 WP_000944149.1.43200 WP_000944149.1.43202 WP_000944149.1.43206 WP_000944149.1.43232 WP_000944149.1.43248 WP_000944149.1.4325 WP_000944149.1.43263 WP_000944149.1.4327 WP_000944149.1.43274 WP_000944149.1.43341 WP_000944149.1.43349 WP_000944149.1.43369 WP_000944149.1.4337 WP_000944149.1.43375 WP_000944149.1.43406 WP_000944149.1.4341 WP_000944149.1.43414 WP_000944149.1.43460 WP_000944149.1.4347 WP_000944149.1.43506 WP_000944149.1.43530 WP_000944149.1.43550 WP_000944149.1.43560 WP_000944149.1.43617 WP_000944149.1.43618 WP_000944149.1.43627 WP_000944149.1.43659 WP_000944149.1.43670 WP_000944149.1.43693 WP_000944149.1.43702 WP_000944149.1.43703 WP_000944149.1.4372 WP_000944149.1.43731 WP_000944149.1.43752 WP_000944149.1.43784 WP_000944149.1.43788 WP_000944149.1.43819 WP_000944149.1.43827 WP_000944149.1.4385 WP_000944149.1.43904 WP_000944149.1.43915 WP_000944149.1.43988 WP_000944149.1.43995 WP_000944149.1.44074 WP_000944149.1.44119 WP_000944149.1.44153 WP_000944149.1.44181 WP_000944149.1.44186 WP_000944149.1.44195 WP_000944149.1.44265 WP_000944149.1.44302 WP_000944149.1.44331 WP_000944149.1.44388 WP_000944149.1.44396 WP_000944149.1.44405 WP_000944149.1.44420 WP_000944149.1.44432 WP_000944149.1.44504 WP_000944149.1.44515 WP_000944149.1.44536 WP_000944149.1.44579 WP_000944149.1.44588 WP_000944149.1.44605 WP_000944149.1.44631 WP_000944149.1.44672 WP_000944149.1.447 WP_000944149.1.44715 WP_000944149.1.44732 WP_000944149.1.44755 WP_000944149.1.44780 WP_000944149.1.44785 WP_000944149.1.44788 WP_000944149.1.44796 WP_000944149.1.44876 WP_000944149.1.44881 WP_000944149.1.44882 WP_000944149.1.44899 WP_000944149.1.44914 WP_000944149.1.44955 WP_000944149.1.4499 WP_000944149.1.45008 WP_000944149.1.45033 WP_000944149.1.45035 WP_000944149.1.45042 WP_000944149.1.45050 WP_000944149.1.45099 WP_000944149.1.45114 WP_000944149.1.4513 WP_000944149.1.45133 WP_000944149.1.45164 WP_000944149.1.45170 WP_000944149.1.452 WP_000944149.1.45221 WP_000944149.1.45242 WP_000944149.1.45272 WP_000944149.1.45281 WP_000944149.1.45290 WP_000944149.1.45297 WP_000944149.1.453 WP_000944149.1.45364 WP_000944149.1.45419 WP_000944149.1.45431 WP_000944149.1.45439 WP_000944149.1.45472 WP_000944149.1.4550 WP_000944149.1.45507 WP_000944149.1.45560 WP_000944149.1.45577 WP_000944149.1.45610 WP_000944149.1.45670 WP_000944149.1.45703 WP_000944149.1.45705 WP_000944149.1.45734 WP_000944149.1.45768 WP_000944149.1.45771 WP_000944149.1.45780 WP_000944149.1.4582 WP_000944149.1.4584 WP_000944149.1.45852 WP_000944149.1.45859 WP_000944149.1.45878 WP_000944149.1.45897 WP_000944149.1.45954 WP_000944149.1.4597 WP_000944149.1.45977 WP_000944149.1.45979 WP_000944149.1.4598 WP_000944149.1.46003 WP_000944149.1.46005 WP_000944149.1.46013 WP_000944149.1.46050 WP_000944149.1.46055 WP_000944149.1.46087 WP_000944149.1.46109 WP_000944149.1.46168 WP_000944149.1.46185 WP_000944149.1.46195 WP_000944149.1.46208 WP_000944149.1.46222 WP_000944149.1.46228 WP_000944149.1.46248 WP_000944149.1.46276 WP_000944149.1.46330 WP_000944149.1.46333 WP_000944149.1.46334 WP_000944149.1.46362 WP_000944149.1.46368 WP_000944149.1.46380 WP_000944149.1.46401 WP_000944149.1.46422 WP_000944149.1.46465 WP_000944149.1.46514 WP_000944149.1.46529 WP_000944149.1.46543 WP_000944149.1.4662 WP_000944149.1.46660 WP_000944149.1.46664 WP_000944149.1.46670 WP_000944149.1.46692 WP_000944149.1.46702 WP_000944149.1.46703 WP_000944149.1.46752 WP_000944149.1.46765 WP_000944149.1.4680 WP_000944149.1.46815 WP_000944149.1.46852 WP_000944149.1.46881 WP_000944149.1.46906 WP_000944149.1.46908 WP_000944149.1.46925 WP_000944149.1.46937 WP_000944149.1.4696 WP_000944149.1.46965 WP_000944149.1.46983 WP_000944149.1.46995 WP_000944149.1.47051 WP_000944149.1.47128 WP_000944149.1.47153 WP_000944149.1.47159 WP_000944149.1.47163 WP_000944149.1.47175 WP_000944149.1.47187 WP_000944149.1.47211 WP_000944149.1.47216 WP_000944149.1.47258 WP_000944149.1.47269 WP_000944149.1.47276 WP_000944149.1.47279 WP_000944149.1.4728 WP_000944149.1.47290 WP_000944149.1.47294 WP_000944149.1.47306 WP_000944149.1.47328 WP_000944149.1.47381 WP_000944149.1.47399 WP_000944149.1.47406 WP_000944149.1.47408 WP_000944149.1.47426 WP_000944149.1.47432 WP_000944149.1.47439 WP_000944149.1.47450 WP_000944149.1.47459 WP_000944149.1.47493 WP_000944149.1.47541 WP_000944149.1.47560 WP_000944149.1.47617 WP_000944149.1.47618 WP_000944149.1.47629 WP_000944149.1.4767 WP_000944149.1.477 WP_000944149.1.47719 WP_000944149.1.47733 WP_000944149.1.47763 WP_000944149.1.47782 WP_000944149.1.47835 WP_000944149.1.47836 WP_000944149.1.47851 WP_000944149.1.47859 WP_000944149.1.47872 WP_000944149.1.47873 WP_000944149.1.47908 WP_000944149.1.47989 WP_000944149.1.47996 WP_000944149.1.48011 WP_000944149.1.48030 WP_000944149.1.48047 WP_000944149.1.4805 WP_000944149.1.48149 WP_000944149.1.4815 WP_000944149.1.48154 WP_000944149.1.48169 WP_000944149.1.48186 WP_000944149.1.48227 WP_000944149.1.48236 WP_000944149.1.48250 WP_000944149.1.48282 WP_000944149.1.48284 WP_000944149.1.48293 WP_000944149.1.48307 WP_000944149.1.48322 WP_000944149.1.48391 WP_000944149.1.48394 WP_000944149.1.48425 WP_000944149.1.48463 WP_000944149.1.48563 WP_000944149.1.48577 WP_000944149.1.48593 WP_000944149.1.48634 WP_000944149.1.48656 WP_000944149.1.4868 WP_000944149.1.48705 WP_000944149.1.48711 WP_000944149.1.48723 WP_000944149.1.48775 WP_000944149.1.48805 WP_000944149.1.48818 WP_000944149.1.48823 WP_000944149.1.48833 WP_000944149.1.48835 WP_000944149.1.4886 WP_000944149.1.48936 WP_000944149.1.48941 WP_000944149.1.48945 WP_000944149.1.48951 WP_000944149.1.48966 WP_000944149.1.48968 WP_000944149.1.48982 WP_000944149.1.48993 WP_000944149.1.4901 WP_000944149.1.4905 WP_000944149.1.49105 WP_000944149.1.49128 WP_000944149.1.49129 WP_000944149.1.49154 WP_000944149.1.49159 WP_000944149.1.4916 WP_000944149.1.49161 WP_000944149.1.4917 WP_000944149.1.49173 WP_000944149.1.4918 WP_000944149.1.49199 WP_000944149.1.49207 WP_000944149.1.49234 WP_000944149.1.49248 WP_000944149.1.49257 WP_000944149.1.49301 WP_000944149.1.49327 WP_000944149.1.49330 WP_000944149.1.49398 WP_000944149.1.4945 WP_000944149.1.4950 WP_000944149.1.49581 WP_000944149.1.4962 WP_000944149.1.49653 WP_000944149.1.49669 WP_000944149.1.49690 WP_000944149.1.49704 WP_000944149.1.49715 WP_000944149.1.49730 WP_000944149.1.49742 WP_000944149.1.49745 WP_000944149.1.4980 WP_000944149.1.49800 WP_000944149.1.49860 WP_000944149.1.49863 WP_000944149.1.49871 WP_000944149.1.4989 WP_000944149.1.49894 WP_000944149.1.49907 WP_000944149.1.49913 WP_000944149.1.49934 WP_000944149.1.49936 WP_000944149.1.4994 WP_000944149.1.49970 WP_000944149.1.49982 WP_000944149.1.50013 WP_000944149.1.50015 WP_000944149.1.50038 WP_000944149.1.50039 WP_000944149.1.50061 WP_000944149.1.50076 WP_000944149.1.5013 WP_000944149.1.50138 WP_000944149.1.50217 WP_000944149.1.50219 WP_000944149.1.50229 WP_000944149.1.50261 WP_000944149.1.50313 WP_000944149.1.50314 WP_000944149.1.50356 WP_000944149.1.50360 WP_000944149.1.50388 WP_000944149.1.50425 WP_000944149.1.50430 WP_000944149.1.50431 WP_000944149.1.5045 WP_000944149.1.50464 WP_000944149.1.50516 WP_000944149.1.50536 WP_000944149.1.50555 WP_000944149.1.50568 WP_000944149.1.50578 WP_000944149.1.50595 WP_000944149.1.50660 WP_000944149.1.50669 WP_000944149.1.50759 WP_000944149.1.50768 WP_000944149.1.50799 WP_000944149.1.50820 WP_000944149.1.50827 WP_000944149.1.50884 WP_000944149.1.50896 WP_000944149.1.50937 WP_000944149.1.50962 WP_000944149.1.51008 WP_000944149.1.51062 WP_000944149.1.51085 WP_000944149.1.5109 WP_000944149.1.5110 WP_000944149.1.5111 WP_000944149.1.51138 WP_000944149.1.51152 WP_000944149.1.51220 WP_000944149.1.51226 WP_000944149.1.51236 WP_000944149.1.51245 WP_000944149.1.51250 WP_000944149.1.51277 WP_000944149.1.51282 WP_000944149.1.51295 WP_000944149.1.51306 WP_000944149.1.51310 WP_000944149.1.51346 WP_000944149.1.51376 WP_000944149.1.51393 WP_000944149.1.51403 WP_000944149.1.51454 WP_000944149.1.51456 WP_000944149.1.51492 WP_000944149.1.515 WP_000944149.1.51527 WP_000944149.1.5155 WP_000944149.1.51559 WP_000944149.1.51575 WP_000944149.1.51590 WP_000944149.1.51665 WP_000944149.1.51716 WP_000944149.1.51744 WP_000944149.1.51748 WP_000944149.1.51787 WP_000944149.1.51797 WP_000944149.1.51812 WP_000944149.1.51836 WP_000944149.1.51842 WP_000944149.1.51844 WP_000944149.1.5186 WP_000944149.1.51871 WP_000944149.1.51883 WP_000944149.1.5190 WP_000944149.1.51912 WP_000944149.1.51920 WP_000944149.1.51924 WP_000944149.1.51936 WP_000944149.1.51952 WP_000944149.1.51995 WP_000944149.1.52061 WP_000944149.1.52078 WP_000944149.1.521 WP_000944149.1.5213 WP_000944149.1.52151 WP_000944149.1.52162 WP_000944149.1.52182 WP_000944149.1.52185 WP_000944149.1.52193 WP_000944149.1.52195 WP_000944149.1.52251 WP_000944149.1.52252 WP_000944149.1.52259 WP_000944149.1.52296 WP_000944149.1.523 WP_000944149.1.52322 WP_000944149.1.52327 WP_000944149.1.52331 WP_000944149.1.52340 WP_000944149.1.52440 WP_000944149.1.52442 WP_000944149.1.52463 WP_000944149.1.52518 WP_000944149.1.52536 WP_000944149.1.52548 WP_000944149.1.52595 WP_000944149.1.52605 WP_000944149.1.52623 WP_000944149.1.52624 WP_000944149.1.52633 WP_000944149.1.52645 WP_000944149.1.52670 WP_000944149.1.52687 WP_000944149.1.52699 WP_000944149.1.52715 WP_000944149.1.52722 WP_000944149.1.52772 WP_000944149.1.52820 WP_000944149.1.52830 WP_000944149.1.52838 WP_000944149.1.52848 WP_000944149.1.52877 WP_000944149.1.52878 WP_000944149.1.52900 WP_000944149.1.52904 WP_000944149.1.52941 WP_000944149.1.52947 WP_000944149.1.52984 WP_000944149.1.53002 WP_000944149.1.53007 WP_000944149.1.53071 WP_000944149.1.53077 WP_000944149.1.53140 WP_000944149.1.53153 WP_000944149.1.53178 WP_000944149.1.5319 WP_000944149.1.53209 WP_000944149.1.53260 WP_000944149.1.53317 WP_000944149.1.53319 WP_000944149.1.53323 WP_000944149.1.53372 WP_000944149.1.53394 WP_000944149.1.53403 WP_000944149.1.53418 WP_000944149.1.53432 WP_000944149.1.53462 WP_000944149.1.53467 WP_000944149.1.53521 WP_000944149.1.53577 WP_000944149.1.53641 WP_000944149.1.53648 WP_000944149.1.53661 WP_000944149.1.53671 WP_000944149.1.53682 WP_000944149.1.53691 WP_000944149.1.53712 WP_000944149.1.53714 WP_000944149.1.53763 WP_000944149.1.53766 WP_000944149.1.53786 WP_000944149.1.53827 WP_000944149.1.53835 WP_000944149.1.53889 WP_000944149.1.53911 WP_000944149.1.53915 WP_000944149.1.53934 WP_000944149.1.53969 WP_000944149.1.53999 WP_000944149.1.5401 WP_000944149.1.54022 WP_000944149.1.54109 WP_000944149.1.54135 WP_000944149.1.54147 WP_000944149.1.54229 WP_000944149.1.54253 WP_000944149.1.54269 WP_000944149.1.54297 WP_000944149.1.54299 WP_000944149.1.54395 WP_000944149.1.544 WP_000944149.1.54413 WP_000944149.1.54438 WP_000944149.1.54446 WP_000944149.1.54477 WP_000944149.1.54485 WP_000944149.1.54491 WP_000944149.1.54503 WP_000944149.1.54510 WP_000944149.1.54551 WP_000944149.1.54554 WP_000944149.1.54637 WP_000944149.1.54675 WP_000944149.1.5469 WP_000944149.1.54744 WP_000944149.1.54745 WP_000944149.1.54753 WP_000944149.1.54847 WP_000944149.1.54878 WP_000944149.1.54914 WP_000944149.1.54955 WP_000944149.1.54967 WP_000944149.1.55014 WP_000944149.1.55058 WP_000944149.1.55084 WP_000944149.1.55090 WP_000944149.1.55139 WP_000944149.1.5519 WP_000944149.1.55214 WP_000944149.1.55274 WP_000944149.1.55309 WP_000944149.1.55327 WP_000944149.1.55352 WP_000944149.1.55367 WP_000944149.1.55369 WP_000944149.1.55403 WP_000944149.1.55405 WP_000944149.1.55421 WP_000944149.1.55508 WP_000944149.1.5554 WP_000944149.1.55544 WP_000944149.1.55558 WP_000944149.1.5556 WP_000944149.1.55583 WP_000944149.1.5559 WP_000944149.1.55620 WP_000944149.1.55628 WP_000944149.1.55637 WP_000944149.1.5565 WP_000944149.1.55653 WP_000944149.1.557 WP_000944149.1.55717 WP_000944149.1.55728 WP_000944149.1.5575 WP_000944149.1.55786 WP_000944149.1.5580 WP_000944149.1.55818 WP_000944149.1.55831 WP_000944149.1.55835 WP_000944149.1.55839 WP_000944149.1.55848 WP_000944149.1.55859 WP_000944149.1.55867 WP_000944149.1.55886 WP_000944149.1.5589 WP_000944149.1.55904 WP_000944149.1.55916 WP_000944149.1.55933 WP_000944149.1.55953 WP_000944149.1.56000 WP_000944149.1.56025 WP_000944149.1.56048 WP_000944149.1.56064 WP_000944149.1.56078 WP_000944149.1.56098 WP_000944149.1.56099 WP_000944149.1.56200 WP_000944149.1.56210 WP_000944149.1.56213 WP_000944149.1.56220 WP_000944149.1.56225 WP_000944149.1.5623 WP_000944149.1.56239 WP_000944149.1.56241 WP_000944149.1.56260 WP_000944149.1.56272 WP_000944149.1.56275 WP_000944149.1.56281 WP_000944149.1.56332 WP_000944149.1.56333 WP_000944149.1.5635 WP_000944149.1.56364 WP_000944149.1.56377 WP_000944149.1.56400 WP_000944149.1.5644 WP_000944149.1.56464 WP_000944149.1.56482 WP_000944149.1.56522 WP_000944149.1.56525 WP_000944149.1.56527 WP_000944149.1.56558 WP_000944149.1.5658 WP_000944149.1.56598 WP_000944149.1.566 WP_000944149.1.56628 WP_000944149.1.56641 WP_000944149.1.56658 WP_000944149.1.5666 WP_000944149.1.56679 WP_000944149.1.56702 WP_000944149.1.5677 WP_000944149.1.56778 WP_000944149.1.56794 WP_000944149.1.56815 WP_000944149.1.56822 WP_000944149.1.56856 WP_000944149.1.5686 WP_000944149.1.56865 WP_000944149.1.56878 WP_000944149.1.569 WP_000944149.1.56986 WP_000944149.1.57047 WP_000944149.1.5705 WP_000944149.1.57073 WP_000944149.1.57075 WP_000944149.1.57080 WP_000944149.1.57097 WP_000944149.1.57109 WP_000944149.1.57141 WP_000944149.1.57158 WP_000944149.1.57170 WP_000944149.1.5718 WP_000944149.1.57190 WP_000944149.1.57196 WP_000944149.1.57214 WP_000944149.1.57265 WP_000944149.1.57271 WP_000944149.1.57291 WP_000944149.1.57309 WP_000944149.1.5735 WP_000944149.1.57385 WP_000944149.1.57427 WP_000944149.1.5743 WP_000944149.1.57445 WP_000944149.1.57448 WP_000944149.1.57481 WP_000944149.1.57594 WP_000944149.1.57612 WP_000944149.1.57635 WP_000944149.1.57650 WP_000944149.1.57665 WP_000944149.1.57682 WP_000944149.1.57692 WP_000944149.1.57723 WP_000944149.1.57727 WP_000944149.1.57730 WP_000944149.1.57734 WP_000944149.1.57745 WP_000944149.1.57754 WP_000944149.1.57808 WP_000944149.1.57819 WP_000944149.1.57837 WP_000944149.1.57840 WP_000944149.1.57844 WP_000944149.1.57861 WP_000944149.1.57878 WP_000944149.1.5791 WP_000944149.1.57928 WP_000944149.1.57943 WP_000944149.1.57952 WP_000944149.1.57974 WP_000944149.1.58016 WP_000944149.1.58049 WP_000944149.1.58051 WP_000944149.1.58074 WP_000944149.1.58116 WP_000944149.1.58127 WP_000944149.1.58139 WP_000944149.1.58148 WP_000944149.1.58158 WP_000944149.1.5816 WP_000944149.1.5827 WP_000944149.1.58277 WP_000944149.1.58317 WP_000944149.1.58352 WP_000944149.1.58364 WP_000944149.1.58395 WP_000944149.1.58419 WP_000944149.1.58421 WP_000944149.1.58430 WP_000944149.1.58435 WP_000944149.1.58512 WP_000944149.1.58530 WP_000944149.1.58538 WP_000944149.1.5857 WP_000944149.1.58571 WP_000944149.1.58584 WP_000944149.1.58588 WP_000944149.1.58592 WP_000944149.1.58598 WP_000944149.1.58704 WP_000944149.1.58735 WP_000944149.1.58760 WP_000944149.1.58763 WP_000944149.1.58772 WP_000944149.1.5880 WP_000944149.1.58833 WP_000944149.1.58855 WP_000944149.1.58860 WP_000944149.1.58934 WP_000944149.1.58936 WP_000944149.1.58960 WP_000944149.1.58981 WP_000944149.1.58998 WP_000944149.1.59011 WP_000944149.1.59014 WP_000944149.1.59039 WP_000944149.1.5904 WP_000944149.1.59077 WP_000944149.1.59098 WP_000944149.1.59124 WP_000944149.1.59133 WP_000944149.1.59146 WP_000944149.1.59178 WP_000944149.1.5920 WP_000944149.1.59311 WP_000944149.1.59327 WP_000944149.1.59334 WP_000944149.1.59397 WP_000944149.1.59398 WP_000944149.1.5940 WP_000944149.1.59404 WP_000944149.1.59414 WP_000944149.1.59462 WP_000944149.1.59464 WP_000944149.1.59478 WP_000944149.1.59498 WP_000944149.1.59540 WP_000944149.1.59546 WP_000944149.1.59594 WP_000944149.1.59598 WP_000944149.1.59609 WP_000944149.1.59663 WP_000944149.1.59668 WP_000944149.1.59669 WP_000944149.1.59671 WP_000944149.1.59697 WP_000944149.1.5972 WP_000944149.1.59736 WP_000944149.1.59787 WP_000944149.1.59803 WP_000944149.1.5982 WP_000944149.1.59822 WP_000944149.1.59864 WP_000944149.1.59874 WP_000944149.1.59881 WP_000944149.1.59907 WP_000944149.1.59915 WP_000944149.1.60006 WP_000944149.1.60022 WP_000944149.1.6006 WP_000944149.1.6011 WP_000944149.1.60118 WP_000944149.1.60123 WP_000944149.1.60147 WP_000944149.1.60149 WP_000944149.1.60156 WP_000944149.1.60157 WP_000944149.1.60158 WP_000944149.1.6017 WP_000944149.1.60181 WP_000944149.1.60201 WP_000944149.1.60227 WP_000944149.1.60302 WP_000944149.1.60339 WP_000944149.1.60345 WP_000944149.1.60353 WP_000944149.1.60355 WP_000944149.1.60360 WP_000944149.1.60434 WP_000944149.1.60492 WP_000944149.1.60547 WP_000944149.1.60551 WP_000944149.1.60585 WP_000944149.1.60595 WP_000944149.1.60636 WP_000944149.1.60641 WP_000944149.1.60719 WP_000944149.1.60730 WP_000944149.1.60734 WP_000944149.1.60742 WP_000944149.1.60750 WP_000944149.1.60751 WP_000944149.1.60758 WP_000944149.1.60759 WP_000944149.1.60765 WP_000944149.1.60778 WP_000944149.1.60813 WP_000944149.1.60820 WP_000944149.1.60845 WP_000944149.1.6085 WP_000944149.1.60859 WP_000944149.1.60869 WP_000944149.1.60888 WP_000944149.1.60912 WP_000944149.1.60923 WP_000944149.1.60934 WP_000944149.1.60946 WP_000944149.1.60948 WP_000944149.1.60965 WP_000944149.1.60981 WP_000944149.1.60991 WP_000944149.1.61009 WP_000944149.1.61013 WP_000944149.1.61019 WP_000944149.1.61026 WP_000944149.1.61029 WP_000944149.1.61030 WP_000944149.1.61031 WP_000944149.1.61082 WP_000944149.1.61115 WP_000944149.1.61139 WP_000944149.1.61152 WP_000944149.1.61188 WP_000944149.1.61189 WP_000944149.1.6119 WP_000944149.1.6123 WP_000944149.1.61263 WP_000944149.1.61271 WP_000944149.1.61289 WP_000944149.1.61313 WP_000944149.1.61316 WP_000944149.1.61318 WP_000944149.1.61324 WP_000944149.1.61327 WP_000944149.1.61346 WP_000944149.1.6136 WP_000944149.1.61375 WP_000944149.1.61421 WP_000944149.1.61430 WP_000944149.1.61439 WP_000944149.1.61440 WP_000944149.1.6149 WP_000944149.1.61515 WP_000944149.1.61555 WP_000944149.1.61585 WP_000944149.1.61597 WP_000944149.1.61615 WP_000944149.1.61639 WP_000944149.1.61653 WP_000944149.1.6166 WP_000944149.1.61705 WP_000944149.1.61709 WP_000944149.1.61713 WP_000944149.1.61749 WP_000944149.1.61776 WP_000944149.1.61800 WP_000944149.1.61802 WP_000944149.1.61831 WP_000944149.1.61838 WP_000944149.1.61843 WP_000944149.1.6188 WP_000944149.1.61897 WP_000944149.1.61903 WP_000944149.1.61910 WP_000944149.1.61936 WP_000944149.1.61962 WP_000944149.1.61970 WP_000944149.1.61976 WP_000944149.1.61978 WP_000944149.1.62002 WP_000944149.1.6201 WP_000944149.1.62028 WP_000944149.1.62069 WP_000944149.1.62071 WP_000944149.1.6208 WP_000944149.1.62096 WP_000944149.1.62127 WP_000944149.1.62247 WP_000944149.1.62254 WP_000944149.1.62346 WP_000944149.1.62352 WP_000944149.1.62367 WP_000944149.1.62382 WP_000944149.1.62392 WP_000944149.1.62398 WP_000944149.1.62409 WP_000944149.1.62429 WP_000944149.1.62453 WP_000944149.1.62462 WP_000944149.1.62474 WP_000944149.1.62496 WP_000944149.1.6250 WP_000944149.1.62537 WP_000944149.1.62539 WP_000944149.1.62553 WP_000944149.1.62563 WP_000944149.1.62602 WP_000944149.1.62653 WP_000944149.1.6266 WP_000944149.1.62671 WP_000944149.1.62674 WP_000944149.1.6268 WP_000944149.1.62684 WP_000944149.1.62685 WP_000944149.1.62723 WP_000944149.1.62764 WP_000944149.1.62771 WP_000944149.1.62822 WP_000944149.1.62824 WP_000944149.1.62831 WP_000944149.1.62863 WP_000944149.1.62880 WP_000944149.1.62925 WP_000944149.1.62970 WP_000944149.1.63003 WP_000944149.1.63004 WP_000944149.1.63021 WP_000944149.1.63027 WP_000944149.1.63052 WP_000944149.1.63070 WP_000944149.1.63083 WP_000944149.1.63107 WP_000944149.1.63139 WP_000944149.1.63140 WP_000944149.1.63182 WP_000944149.1.63220 WP_000944149.1.63255 WP_000944149.1.63266 WP_000944149.1.63288 WP_000944149.1.63289 WP_000944149.1.63304 WP_000944149.1.63313 WP_000944149.1.63319 WP_000944149.1.63322 WP_000944149.1.63333 WP_000944149.1.63341 WP_000944149.1.63411 WP_000944149.1.63441 WP_000944149.1.63469 WP_000944149.1.63471 WP_000944149.1.63510 WP_000944149.1.63540 WP_000944149.1.6355 WP_000944149.1.63565 WP_000944149.1.63589 WP_000944149.1.63617 WP_000944149.1.63672 WP_000944149.1.63673 WP_000944149.1.63678 WP_000944149.1.63704 WP_000944149.1.63726 WP_000944149.1.63729 WP_000944149.1.63751 WP_000944149.1.63759 WP_000944149.1.63763 WP_000944149.1.63774 WP_000944149.1.63828 WP_000944149.1.63890 WP_000944149.1.63894 WP_000944149.1.63907 WP_000944149.1.63947 WP_000944149.1.63975 WP_000944149.1.63998 WP_000944149.1.6403 WP_000944149.1.64060 WP_000944149.1.6408 WP_000944149.1.64181 WP_000944149.1.64192 WP_000944149.1.64232 WP_000944149.1.64250 WP_000944149.1.64367 WP_000944149.1.64368 WP_000944149.1.6438 WP_000944149.1.64408 WP_000944149.1.64434 WP_000944149.1.64446 WP_000944149.1.64456 WP_000944149.1.64457 WP_000944149.1.645 WP_000944149.1.64525 WP_000944149.1.6453 WP_000944149.1.64537 WP_000944149.1.64565 WP_000944149.1.64583 WP_000944149.1.6459 WP_000944149.1.64598 WP_000944149.1.6462 WP_000944149.1.64677 WP_000944149.1.64686 WP_000944149.1.64720 WP_000944149.1.64765 WP_000944149.1.6479 WP_000944149.1.64858 WP_000944149.1.64879 WP_000944149.1.6488 WP_000944149.1.64893 WP_000944149.1.64897 WP_000944149.1.64911 WP_000944149.1.64928 WP_000944149.1.64935 WP_000944149.1.64951 WP_000944149.1.64961 WP_000944149.1.64994 WP_000944149.1.65044 WP_000944149.1.65046 WP_000944149.1.6509 WP_000944149.1.65132 WP_000944149.1.65158 WP_000944149.1.65164 WP_000944149.1.65180 WP_000944149.1.65193 WP_000944149.1.65217 WP_000944149.1.65243 WP_000944149.1.65274 WP_000944149.1.65317 WP_000944149.1.65367 WP_000944149.1.65406 WP_000944149.1.65419 WP_000944149.1.65423 WP_000944149.1.65432 WP_000944149.1.65443 WP_000944149.1.65448 WP_000944149.1.65451 WP_000944149.1.6547 WP_000944149.1.65504 WP_000944149.1.6551 WP_000944149.1.65520 WP_000944149.1.65544 WP_000944149.1.65562 WP_000944149.1.65585 WP_000944149.1.65599 WP_000944149.1.65600 WP_000944149.1.65675 WP_000944149.1.65689 WP_000944149.1.65693 WP_000944149.1.65700 WP_000944149.1.65703 WP_000944149.1.65704 WP_000944149.1.65705 WP_000944149.1.65713 WP_000944149.1.6578 WP_000944149.1.65856 WP_000944149.1.65922 WP_000944149.1.65928 WP_000944149.1.65931 WP_000944149.1.65990 WP_000944149.1.66009 WP_000944149.1.66014 WP_000944149.1.6603 WP_000944149.1.66054 WP_000944149.1.66081 WP_000944149.1.661 WP_000944149.1.6612 WP_000944149.1.66120 WP_000944149.1.66133 WP_000944149.1.66175 WP_000944149.1.66227 WP_000944149.1.66262 WP_000944149.1.66265 WP_000944149.1.66302 WP_000944149.1.66328 WP_000944149.1.66433 WP_000944149.1.66505 WP_000944149.1.66518 WP_000944149.1.66519 WP_000944149.1.66542 WP_000944149.1.66564 WP_000944149.1.66588 WP_000944149.1.66598 WP_000944149.1.66601 WP_000944149.1.66606 WP_000944149.1.66611 WP_000944149.1.6662 WP_000944149.1.66645 WP_000944149.1.66664 WP_000944149.1.66677 WP_000944149.1.6668 WP_000944149.1.66690 WP_000944149.1.66711 WP_000944149.1.6674 WP_000944149.1.66786 WP_000944149.1.66792 WP_000944149.1.66803 WP_000944149.1.66818 WP_000944149.1.66853 WP_000944149.1.66879 WP_000944149.1.66904 WP_000944149.1.66906 WP_000944149.1.6700 WP_000944149.1.67016 WP_000944149.1.67072 WP_000944149.1.67112 WP_000944149.1.67113 WP_000944149.1.67135 WP_000944149.1.67152 WP_000944149.1.67160 WP_000944149.1.67191 WP_000944149.1.6722 WP_000944149.1.6726 WP_000944149.1.67266 WP_000944149.1.67312 WP_000944149.1.67328 WP_000944149.1.67329 WP_000944149.1.67333 WP_000944149.1.67375 WP_000944149.1.67379 WP_000944149.1.6740 WP_000944149.1.67414 WP_000944149.1.67420 WP_000944149.1.67460 WP_000944149.1.67463 WP_000944149.1.67480 WP_000944149.1.67505 WP_000944149.1.67507 WP_000944149.1.67520 WP_000944149.1.67521 WP_000944149.1.67554 WP_000944149.1.67572 WP_000944149.1.67620 WP_000944149.1.67632 WP_000944149.1.67644 WP_000944149.1.67651 WP_000944149.1.67652 WP_000944149.1.67713 WP_000944149.1.67722 WP_000944149.1.67754 WP_000944149.1.67798 WP_000944149.1.67800 WP_000944149.1.67806 WP_000944149.1.67808 WP_000944149.1.67815 WP_000944149.1.67834 WP_000944149.1.6786 WP_000944149.1.67865 WP_000944149.1.67900 WP_000944149.1.67925 WP_000944149.1.67931 WP_000944149.1.67986 WP_000944149.1.68020 WP_000944149.1.68033 WP_000944149.1.68054 WP_000944149.1.68066 WP_000944149.1.6811 WP_000944149.1.68111 WP_000944149.1.68160 WP_000944149.1.68161 WP_000944149.1.68199 WP_000944149.1.68221 WP_000944149.1.68233 WP_000944149.1.68261 WP_000944149.1.68286 WP_000944149.1.68295 WP_000944149.1.68296 WP_000944149.1.68299 WP_000944149.1.6830 WP_000944149.1.68307 WP_000944149.1.68334 WP_000944149.1.6834 WP_000944149.1.68343 WP_000944149.1.68351 WP_000944149.1.68367 WP_000944149.1.6839 WP_000944149.1.68392 WP_000944149.1.68397 WP_000944149.1.68398 WP_000944149.1.68404 WP_000944149.1.68425 WP_000944149.1.68483 WP_000944149.1.68489 WP_000944149.1.68522 WP_000944149.1.68548 WP_000944149.1.68565 WP_000944149.1.68636 WP_000944149.1.68650 WP_000944149.1.68699 WP_000944149.1.68703 WP_000944149.1.68728 WP_000944149.1.68737 WP_000944149.1.68743 WP_000944149.1.68747 WP_000944149.1.68773 WP_000944149.1.68775 WP_000944149.1.68813 WP_000944149.1.68831 WP_000944149.1.68854 WP_000944149.1.68864 WP_000944149.1.68875 WP_000944149.1.68883 WP_000944149.1.68931 WP_000944149.1.68944 WP_000944149.1.69016 WP_000944149.1.69045 WP_000944149.1.69087 WP_000944149.1.69089 WP_000944149.1.691 WP_000944149.1.69105 WP_000944149.1.69162 WP_000944149.1.6917 WP_000944149.1.69191 WP_000944149.1.69213 WP_000944149.1.69219 WP_000944149.1.69222 WP_000944149.1.69237 WP_000944149.1.69251 WP_000944149.1.69349 WP_000944149.1.69366 WP_000944149.1.69395 WP_000944149.1.69412 WP_000944149.1.69415 WP_000944149.1.69476 WP_000944149.1.69483 WP_000944149.1.69489 WP_000944149.1.695 WP_000944149.1.69520 WP_000944149.1.6953 WP_000944149.1.69552 WP_000944149.1.69563 WP_000944149.1.69622 WP_000944149.1.69639 WP_000944149.1.69679 WP_000944149.1.69721 WP_000944149.1.69823 WP_000944149.1.69878 WP_000944149.1.699 WP_000944149.1.69921 WP_000944149.1.69987 WP_000944149.1.70024 WP_000944149.1.70048 WP_000944149.1.70105 WP_000944149.1.7012 WP_000944149.1.70133 WP_000944149.1.70210 WP_000944149.1.7024 WP_000944149.1.70253 WP_000944149.1.70266 WP_000944149.1.70273 WP_000944149.1.7034 WP_000944149.1.70344 WP_000944149.1.70349 WP_000944149.1.7043 WP_000944149.1.70451 WP_000944149.1.70457 WP_000944149.1.70459 WP_000944149.1.7046 WP_000944149.1.70462 WP_000944149.1.70495 WP_000944149.1.7053 WP_000944149.1.70541 WP_000944149.1.70546 WP_000944149.1.70564 WP_000944149.1.7061 WP_000944149.1.70635 WP_000944149.1.70641 WP_000944149.1.7067 WP_000944149.1.70672 WP_000944149.1.7073 WP_000944149.1.70818 WP_000944149.1.70823 WP_000944149.1.70850 WP_000944149.1.70855 WP_000944149.1.70924 WP_000944149.1.70930 WP_000944149.1.70939 WP_000944149.1.70943 WP_000944149.1.70994 WP_000944149.1.71016 WP_000944149.1.71027 WP_000944149.1.71043 WP_000944149.1.7105 WP_000944149.1.71058 WP_000944149.1.71059 WP_000944149.1.71073 WP_000944149.1.7109 WP_000944149.1.71130 WP_000944149.1.71143 WP_000944149.1.71179 WP_000944149.1.71196 WP_000944149.1.7120 WP_000944149.1.71208 WP_000944149.1.7125 WP_000944149.1.71257 WP_000944149.1.71266 WP_000944149.1.71280 WP_000944149.1.71295 WP_000944149.1.71298 WP_000944149.1.71301 WP_000944149.1.71345 WP_000944149.1.71359 WP_000944149.1.71404 WP_000944149.1.71410 WP_000944149.1.71428 WP_000944149.1.71438 WP_000944149.1.71463 WP_000944149.1.71475 WP_000944149.1.71483 WP_000944149.1.7150 WP_000944149.1.71519 WP_000944149.1.71529 WP_000944149.1.71541 WP_000944149.1.71547 WP_000944149.1.71590 WP_000944149.1.71596 WP_000944149.1.71602 WP_000944149.1.7161 WP_000944149.1.71662 WP_000944149.1.71676 WP_000944149.1.71715 WP_000944149.1.71735 WP_000944149.1.71739 WP_000944149.1.71771 WP_000944149.1.7179 WP_000944149.1.71800 WP_000944149.1.71828 WP_000944149.1.71836 WP_000944149.1.71861 WP_000944149.1.71925 WP_000944149.1.71981 WP_000944149.1.71989 WP_000944149.1.72026 WP_000944149.1.72031 WP_000944149.1.72067 WP_000944149.1.72169 WP_000944149.1.72205 WP_000944149.1.72257 WP_000944149.1.72271 WP_000944149.1.72330 WP_000944149.1.72347 WP_000944149.1.7236 WP_000944149.1.72366 WP_000944149.1.72424 WP_000944149.1.72489 WP_000944149.1.72529 WP_000944149.1.72547 WP_000944149.1.7258 WP_000944149.1.72654 WP_000944149.1.72760 WP_000944149.1.72832 WP_000944149.1.72834 WP_000944149.1.72874 WP_000944149.1.72903 WP_000944149.1.72904 WP_000944149.1.72935 WP_000944149.1.7294 WP_000944149.1.72945 WP_000944149.1.72961 WP_000944149.1.73017 WP_000944149.1.73019 WP_000944149.1.73022 WP_000944149.1.73037 WP_000944149.1.73122 WP_000944149.1.73132 WP_000944149.1.73140 WP_000944149.1.73246 WP_000944149.1.73265 WP_000944149.1.73286 WP_000944149.1.73386 WP_000944149.1.73456 WP_000944149.1.73489 WP_000944149.1.73501 WP_000944149.1.73536 WP_000944149.1.73547 WP_000944149.1.73571 WP_000944149.1.73591 WP_000944149.1.736 WP_000944149.1.73639 WP_000944149.1.73685 WP_000944149.1.73687 WP_000944149.1.73735 WP_000944149.1.73740 WP_000944149.1.73786 WP_000944149.1.7380 WP_000944149.1.73834 WP_000944149.1.73837 WP_000944149.1.73858 WP_000944149.1.73910 WP_000944149.1.73920 WP_000944149.1.73921 WP_000944149.1.73961 WP_000944149.1.73969 WP_000944149.1.73976 WP_000944149.1.73983 WP_000944149.1.74006 WP_000944149.1.7401 WP_000944149.1.74010 WP_000944149.1.74025 WP_000944149.1.74027 WP_000944149.1.7406 WP_000944149.1.74081 WP_000944149.1.74157 WP_000944149.1.74161 WP_000944149.1.74173 WP_000944149.1.74183 WP_000944149.1.74216 WP_000944149.1.74234 WP_000944149.1.74237 WP_000944149.1.7427 WP_000944149.1.74273 WP_000944149.1.7434 WP_000944149.1.74353 WP_000944149.1.74356 WP_000944149.1.74380 WP_000944149.1.74429 WP_000944149.1.74457 WP_000944149.1.7457 WP_000944149.1.74587 WP_000944149.1.74610 WP_000944149.1.74638 WP_000944149.1.74676 WP_000944149.1.74681 WP_000944149.1.74696 WP_000944149.1.74704 WP_000944149.1.74731 WP_000944149.1.74747 WP_000944149.1.74758 WP_000944149.1.74761 WP_000944149.1.74785 WP_000944149.1.74797 WP_000944149.1.74802 WP_000944149.1.74866 WP_000944149.1.74874 WP_000944149.1.74890 WP_000944149.1.74911 WP_000944149.1.74922 WP_000944149.1.74924 WP_000944149.1.74961 WP_000944149.1.74985 WP_000944149.1.74994 WP_000944149.1.74999 WP_000944149.1.75038 WP_000944149.1.75044 WP_000944149.1.75052 WP_000944149.1.75093 WP_000944149.1.75127 WP_000944149.1.75132 WP_000944149.1.75141 WP_000944149.1.75186 WP_000944149.1.75227 WP_000944149.1.75252 WP_000944149.1.75253 WP_000944149.1.75294 WP_000944149.1.75298 WP_000944149.1.75320 WP_000944149.1.75327 WP_000944149.1.75349 WP_000944149.1.75365 WP_000944149.1.75399 WP_000944149.1.7542 WP_000944149.1.75438 WP_000944149.1.75521 WP_000944149.1.75527 WP_000944149.1.75551 WP_000944149.1.75590 WP_000944149.1.7561 WP_000944149.1.75647 WP_000944149.1.75649 WP_000944149.1.75652 WP_000944149.1.75685 WP_000944149.1.75704 WP_000944149.1.75728 WP_000944149.1.75769 WP_000944149.1.75775 WP_000944149.1.758 WP_000944149.1.75805 WP_000944149.1.75809 WP_000944149.1.75830 WP_000944149.1.75881 WP_000944149.1.75885 WP_000944149.1.75929 WP_000944149.1.75944 WP_000944149.1.75952 WP_000944149.1.7596 WP_000944149.1.75969 WP_000944149.1.76010 WP_000944149.1.76015 WP_000944149.1.7602 WP_000944149.1.76050 WP_000944149.1.76095 WP_000944149.1.76104 WP_000944149.1.76123 WP_000944149.1.76143 WP_000944149.1.76149 WP_000944149.1.76230 WP_000944149.1.76234 WP_000944149.1.7624 WP_000944149.1.7625 WP_000944149.1.76258 WP_000944149.1.76261 WP_000944149.1.76332 WP_000944149.1.76337 WP_000944149.1.76351 WP_000944149.1.76419 WP_000944149.1.76420 WP_000944149.1.76421 WP_000944149.1.76424 WP_000944149.1.76426 WP_000944149.1.76463 WP_000944149.1.76482 WP_000944149.1.76606 WP_000944149.1.76624 WP_000944149.1.76648 WP_000944149.1.76659 WP_000944149.1.76686 WP_000944149.1.76689 WP_000944149.1.76690 WP_000944149.1.76693 WP_000944149.1.7675 WP_000944149.1.76790 WP_000944149.1.76792 WP_000944149.1.768 WP_000944149.1.76816 WP_000944149.1.76825 WP_000944149.1.76839 WP_000944149.1.76845 WP_000944149.1.76869 WP_000944149.1.76895 WP_000944149.1.76897 WP_000944149.1.76921 WP_000944149.1.76944 WP_000944149.1.76952 WP_000944149.1.76998 WP_000944149.1.77031 WP_000944149.1.77041 WP_000944149.1.77050 WP_000944149.1.77060 WP_000944149.1.77062 WP_000944149.1.77072 WP_000944149.1.77112 WP_000944149.1.77144 WP_000944149.1.77145 WP_000944149.1.77190 WP_000944149.1.77305 WP_000944149.1.77331 WP_000944149.1.77346 WP_000944149.1.77388 WP_000944149.1.77426 WP_000944149.1.7745 WP_000944149.1.7746 WP_000944149.1.77485 WP_000944149.1.77489 WP_000944149.1.77497 WP_000944149.1.7752 WP_000944149.1.77520 WP_000944149.1.77527 WP_000944149.1.77533 WP_000944149.1.77536 WP_000944149.1.77572 WP_000944149.1.77583 WP_000944149.1.77603 WP_000944149.1.77606 WP_000944149.1.77733 WP_000944149.1.77738 WP_000944149.1.7774 WP_000944149.1.77743 WP_000944149.1.77791 WP_000944149.1.77818 WP_000944149.1.77822 WP_000944149.1.77848 WP_000944149.1.77858 WP_000944149.1.7786 WP_000944149.1.77860 WP_000944149.1.7787 WP_000944149.1.77883 WP_000944149.1.77957 WP_000944149.1.78054 WP_000944149.1.78091 WP_000944149.1.7810 WP_000944149.1.78173 WP_000944149.1.78189 WP_000944149.1.78194 WP_000944149.1.78207 WP_000944149.1.78208 WP_000944149.1.78252 WP_000944149.1.78254 WP_000944149.1.7827 WP_000944149.1.78311 WP_000944149.1.78324 WP_000944149.1.78332 WP_000944149.1.78365 WP_000944149.1.78404 WP_000944149.1.78434 WP_000944149.1.7850 WP_000944149.1.78558 WP_000944149.1.7857 WP_000944149.1.78585 WP_000944149.1.78604 WP_000944149.1.78638 WP_000944149.1.78653 WP_000944149.1.78667 WP_000944149.1.78728 WP_000944149.1.78803 WP_000944149.1.78819 WP_000944149.1.78841 WP_000944149.1.78897 WP_000944149.1.78946 WP_000944149.1.78978 WP_000944149.1.78983 WP_000944149.1.78991 WP_000944149.1.7900 WP_000944149.1.79006 WP_000944149.1.79038 WP_000944149.1.79051 WP_000944149.1.79059 WP_000944149.1.79085 WP_000944149.1.79110 WP_000944149.1.79131 WP_000944149.1.79156 WP_000944149.1.79170 WP_000944149.1.79197 WP_000944149.1.79208 WP_000944149.1.79223 WP_000944149.1.79227 WP_000944149.1.79270 WP_000944149.1.7931 WP_000944149.1.79310 WP_000944149.1.79314 WP_000944149.1.79322 WP_000944149.1.79332 WP_000944149.1.79367 WP_000944149.1.79374 WP_000944149.1.79378 WP_000944149.1.79400 WP_000944149.1.79402 WP_000944149.1.79436 WP_000944149.1.79452 WP_000944149.1.79461 WP_000944149.1.79476 WP_000944149.1.79487 WP_000944149.1.79539 WP_000944149.1.79626 WP_000944149.1.79638 WP_000944149.1.79662 WP_000944149.1.79672 WP_000944149.1.79706 WP_000944149.1.79737 WP_000944149.1.7981 WP_000944149.1.79822 WP_000944149.1.79831 WP_000944149.1.79834 WP_000944149.1.79837 WP_000944149.1.79854 WP_000944149.1.7989 WP_000944149.1.79896 WP_000944149.1.79911 WP_000944149.1.7992 WP_000944149.1.79941 WP_000944149.1.79949 WP_000944149.1.79961 WP_000944149.1.79971 WP_000944149.1.79991 WP_000944149.1.80000 WP_000944149.1.80029 WP_000944149.1.80032 WP_000944149.1.80042 WP_000944149.1.80079 WP_000944149.1.80109 WP_000944149.1.80122 WP_000944149.1.80127 WP_000944149.1.80146 WP_000944149.1.80152 WP_000944149.1.80181 WP_000944149.1.80184 WP_000944149.1.80203 WP_000944149.1.80286 WP_000944149.1.80287 WP_000944149.1.80290 WP_000944149.1.80297 WP_000944149.1.8030 WP_000944149.1.8031 WP_000944149.1.80317 WP_000944149.1.8035 WP_000944149.1.80358 WP_000944149.1.80378 WP_000944149.1.80389 WP_000944149.1.80393 WP_000944149.1.8043 WP_000944149.1.80472 WP_000944149.1.80530 WP_000944149.1.80647 WP_000944149.1.8065 WP_000944149.1.80687 WP_000944149.1.80717 WP_000944149.1.80761 WP_000944149.1.80762 WP_000944149.1.80763 WP_000944149.1.8077 WP_000944149.1.80781 WP_000944149.1.80786 WP_000944149.1.80833 WP_000944149.1.8084 WP_000944149.1.80845 WP_000944149.1.80855 WP_000944149.1.80872 WP_000944149.1.809 WP_000944149.1.80962 WP_000944149.1.80972 WP_000944149.1.81010 WP_000944149.1.81022 WP_000944149.1.81049 WP_000944149.1.81064 WP_000944149.1.81085 WP_000944149.1.81095 WP_000944149.1.81114 WP_000944149.1.81132 WP_000944149.1.81157 WP_000944149.1.81171 WP_000944149.1.81214 WP_000944149.1.81224 WP_000944149.1.81232 WP_000944149.1.81234 WP_000944149.1.81243 WP_000944149.1.8125 WP_000944149.1.81252 WP_000944149.1.8135 WP_000944149.1.81379 WP_000944149.1.81384 WP_000944149.1.81385 WP_000944149.1.81387 WP_000944149.1.81389 WP_000944149.1.8142 WP_000944149.1.8144 WP_000944149.1.81464 WP_000944149.1.81467 WP_000944149.1.81532 WP_000944149.1.81599 WP_000944149.1.81610 WP_000944149.1.81738 WP_000944149.1.81740 WP_000944149.1.81758 WP_000944149.1.81789 WP_000944149.1.8180 WP_000944149.1.81800 WP_000944149.1.81810 WP_000944149.1.81812 WP_000944149.1.81829 WP_000944149.1.81831 WP_000944149.1.81861 WP_000944149.1.81870 WP_000944149.1.81897 WP_000944149.1.81903 WP_000944149.1.81905 WP_000944149.1.81906 WP_000944149.1.81919 WP_000944149.1.81944 WP_000944149.1.81955 WP_000944149.1.81982 WP_000944149.1.81990 WP_000944149.1.81999 WP_000944149.1.82009 WP_000944149.1.82017 WP_000944149.1.82053 WP_000944149.1.8212 WP_000944149.1.82121 WP_000944149.1.82174 WP_000944149.1.82219 WP_000944149.1.82234 WP_000944149.1.82247 WP_000944149.1.82259 WP_000944149.1.82315 WP_000944149.1.82340 WP_000944149.1.82349 WP_000944149.1.82354 WP_000944149.1.82358 WP_000944149.1.82368 WP_000944149.1.82447 WP_000944149.1.82455 WP_000944149.1.8246 WP_000944149.1.82467 WP_000944149.1.82548 WP_000944149.1.8261 WP_000944149.1.82612 WP_000944149.1.8265 WP_000944149.1.82664 WP_000944149.1.82709 WP_000944149.1.82724 WP_000944149.1.82796 WP_000944149.1.8280 WP_000944149.1.82802 WP_000944149.1.82829 WP_000944149.1.82862 WP_000944149.1.8288 WP_000944149.1.8289 WP_000944149.1.82976 WP_000944149.1.82980 WP_000944149.1.8302 WP_000944149.1.83021 WP_000944149.1.83054 WP_000944149.1.83066 WP_000944149.1.83078 WP_000944149.1.83152 WP_000944149.1.83153 WP_000944149.1.83185 WP_000944149.1.8319 WP_000944149.1.83193 WP_000944149.1.83234 WP_000944149.1.83249 WP_000944149.1.83250 WP_000944149.1.83291 WP_000944149.1.83316 WP_000944149.1.83352 WP_000944149.1.83372 WP_000944149.1.83405 WP_000944149.1.83418 WP_000944149.1.83476 WP_000944149.1.83484 WP_000944149.1.83517 WP_000944149.1.83593 WP_000944149.1.83597 WP_000944149.1.83624 WP_000944149.1.83646 WP_000944149.1.83653 WP_000944149.1.83676 WP_000944149.1.83720 WP_000944149.1.83750 WP_000944149.1.83763 WP_000944149.1.83769 WP_000944149.1.83775 WP_000944149.1.83792 WP_000944149.1.83804 WP_000944149.1.83816 WP_000944149.1.83825 WP_000944149.1.8383 WP_000944149.1.83844 WP_000944149.1.83864 WP_000944149.1.83865 WP_000944149.1.83868 WP_000944149.1.83881 WP_000944149.1.83905 WP_000944149.1.83912 WP_000944149.1.83919 WP_000944149.1.83928 WP_000944149.1.83955 WP_000944149.1.83984 WP_000944149.1.84010 WP_000944149.1.84049 WP_000944149.1.84064 WP_000944149.1.84118 WP_000944149.1.84129 WP_000944149.1.84144 WP_000944149.1.84161 WP_000944149.1.84163 WP_000944149.1.84194 WP_000944149.1.84275 WP_000944149.1.84293 WP_000944149.1.8432 WP_000944149.1.84342 WP_000944149.1.84414 WP_000944149.1.84415 WP_000944149.1.84442 WP_000944149.1.84445 WP_000944149.1.84451 WP_000944149.1.84509 WP_000944149.1.84563 WP_000944149.1.84578 WP_000944149.1.84625 WP_000944149.1.84638 WP_000944149.1.84673 WP_000944149.1.84679 WP_000944149.1.8468 WP_000944149.1.84682 WP_000944149.1.84696 WP_000944149.1.84714 WP_000944149.1.84736 WP_000944149.1.8475 WP_000944149.1.84752 WP_000944149.1.84757 WP_000944149.1.84761 WP_000944149.1.84815 WP_000944149.1.84874 WP_000944149.1.84889 WP_000944149.1.84903 WP_000944149.1.84907 WP_000944149.1.84922 WP_000944149.1.84924 WP_000944149.1.8493 WP_000944149.1.84951 WP_000944149.1.85022 WP_000944149.1.85047 WP_000944149.1.85056 WP_000944149.1.85081 WP_000944149.1.85099 WP_000944149.1.85133 WP_000944149.1.85135 WP_000944149.1.85144 WP_000944149.1.85151 WP_000944149.1.85160 WP_000944149.1.85198 WP_000944149.1.85226 WP_000944149.1.85235 WP_000944149.1.85238 WP_000944149.1.85265 WP_000944149.1.85289 WP_000944149.1.85292 WP_000944149.1.85331 WP_000944149.1.85351 WP_000944149.1.85354 WP_000944149.1.85383 WP_000944149.1.85391 WP_000944149.1.85395 WP_000944149.1.85401 WP_000944149.1.85404 WP_000944149.1.85425 WP_000944149.1.85445 WP_000944149.1.85462 WP_000944149.1.85471 WP_000944149.1.85474 WP_000944149.1.85492 WP_000944149.1.85506 WP_000944149.1.8551 WP_000944149.1.85515 WP_000944149.1.85519 WP_000944149.1.85547 WP_000944149.1.85549 WP_000944149.1.85562 WP_000944149.1.85586 WP_000944149.1.85596 WP_000944149.1.85611 WP_000944149.1.85634 WP_000944149.1.85649 WP_000944149.1.85758 WP_000944149.1.85795 WP_000944149.1.85796 WP_000944149.1.85816 WP_000944149.1.85834 WP_000944149.1.85927 WP_000944149.1.85950 WP_000944149.1.85971 WP_000944149.1.85980 WP_000944149.1.85989 WP_000944149.1.85993 WP_000944149.1.86018 WP_000944149.1.86072 WP_000944149.1.86086 WP_000944149.1.86123 WP_000944149.1.86136 WP_000944149.1.86144 WP_000944149.1.86153 WP_000944149.1.86154 WP_000944149.1.86158 WP_000944149.1.86188 WP_000944149.1.86197 WP_000944149.1.86207 WP_000944149.1.86209 WP_000944149.1.8627 WP_000944149.1.86270 WP_000944149.1.86281 WP_000944149.1.86331 WP_000944149.1.86344 WP_000944149.1.86367 WP_000944149.1.86378 WP_000944149.1.8641 WP_000944149.1.8643 WP_000944149.1.86439 WP_000944149.1.86455 WP_000944149.1.86482 WP_000944149.1.86523 WP_000944149.1.86531 WP_000944149.1.86542 WP_000944149.1.86606 WP_000944149.1.86628 WP_000944149.1.8663 WP_000944149.1.86664 WP_000944149.1.86706 WP_000944149.1.86736 WP_000944149.1.86792 WP_000944149.1.8681 WP_000944149.1.86838 WP_000944149.1.86881 WP_000944149.1.86911 WP_000944149.1.86916 WP_000944149.1.86940 WP_000944149.1.86961 WP_000944149.1.86968 WP_000944149.1.86977 WP_000944149.1.87021 WP_000944149.1.87042 WP_000944149.1.87057 WP_000944149.1.87072 WP_000944149.1.87090 WP_000944149.1.87119 WP_000944149.1.87122 WP_000944149.1.87133 WP_000944149.1.87141 WP_000944149.1.87175 WP_000944149.1.87194 WP_000944149.1.8720 WP_000944149.1.87221 WP_000944149.1.87236 WP_000944149.1.87260 WP_000944149.1.87261 WP_000944149.1.87272 WP_000944149.1.87285 WP_000944149.1.87290 WP_000944149.1.8731 WP_000944149.1.87363 WP_000944149.1.87396 WP_000944149.1.87457 WP_000944149.1.87461 WP_000944149.1.87466 WP_000944149.1.875 WP_000944149.1.87508 WP_000944149.1.87515 WP_000944149.1.8753 WP_000944149.1.87534 WP_000944149.1.87543 WP_000944149.1.87593 WP_000944149.1.87636 WP_000944149.1.8764 WP_000944149.1.87682 WP_000944149.1.8770 WP_000944149.1.87710 WP_000944149.1.87718 WP_000944149.1.87734 WP_000944149.1.87748 WP_000944149.1.87764 WP_000944149.1.8779 WP_000944149.1.87808 WP_000944149.1.87828 WP_000944149.1.87838 WP_000944149.1.87879 WP_000944149.1.8791 WP_000944149.1.87912 WP_000944149.1.87963 WP_000944149.1.87964 WP_000944149.1.87972 WP_000944149.1.87995 WP_000944149.1.88013 WP_000944149.1.88032 WP_000944149.1.88061 WP_000944149.1.88114 WP_000944149.1.88150 WP_000944149.1.88212 WP_000944149.1.88270 WP_000944149.1.88317 WP_000944149.1.88319 WP_000944149.1.88339 WP_000944149.1.88351 WP_000944149.1.88367 WP_000944149.1.88371 WP_000944149.1.88380 WP_000944149.1.88445 WP_000944149.1.88449 WP_000944149.1.88473 WP_000944149.1.88480 WP_000944149.1.88498 WP_000944149.1.88504 WP_000944149.1.88518 WP_000944149.1.88555 WP_000944149.1.88558 WP_000944149.1.8857 WP_000944149.1.88572 WP_000944149.1.88580 WP_000944149.1.88599 WP_000944149.1.88623 WP_000944149.1.88636 WP_000944149.1.88638 WP_000944149.1.88642 WP_000944149.1.88671 WP_000944149.1.88694 WP_000944149.1.88696 WP_000944149.1.8872 WP_000944149.1.88739 WP_000944149.1.88753 WP_000944149.1.88761 WP_000944149.1.8877 WP_000944149.1.88771 WP_000944149.1.88856 WP_000944149.1.88859 WP_000944149.1.8886 WP_000944149.1.8888 WP_000944149.1.88881 WP_000944149.1.88897 WP_000944149.1.88934 WP_000944149.1.88987 WP_000944149.1.8900 WP_000944149.1.89027 WP_000944149.1.89086 WP_000944149.1.89108 WP_000944149.1.8913 WP_000944149.1.89133 WP_000944149.1.89139 WP_000944149.1.89181 WP_000944149.1.89194 WP_000944149.1.89195 WP_000944149.1.89204 WP_000944149.1.89216 WP_000944149.1.8924 WP_000944149.1.89258 WP_000944149.1.89284 WP_000944149.1.89372 WP_000944149.1.89476 WP_000944149.1.8950 WP_000944149.1.89516 WP_000944149.1.89537 WP_000944149.1.89544 WP_000944149.1.89545 WP_000944149.1.89556 WP_000944149.1.89557 WP_000944149.1.89559 WP_000944149.1.89603 WP_000944149.1.89655 WP_000944149.1.89672 WP_000944149.1.89678 WP_000944149.1.89686 WP_000944149.1.89726 WP_000944149.1.89730 WP_000944149.1.89754 WP_000944149.1.89799 WP_000944149.1.89857 WP_000944149.1.89883 WP_000944149.1.89908 WP_000944149.1.89924 WP_000944149.1.89935 WP_000944149.1.89960 WP_000944149.1.90005 WP_000944149.1.90018 WP_000944149.1.90038 WP_000944149.1.90046 WP_000944149.1.90055 WP_000944149.1.90091 WP_000944149.1.90095 WP_000944149.1.90131 WP_000944149.1.90145 WP_000944149.1.90148 WP_000944149.1.90161 WP_000944149.1.90174 WP_000944149.1.90180 WP_000944149.1.90215 WP_000944149.1.90217 WP_000944149.1.9022 WP_000944149.1.90243 WP_000944149.1.90253 WP_000944149.1.90276 WP_000944149.1.9030 WP_000944149.1.90331 WP_000944149.1.90345 WP_000944149.1.90367 WP_000944149.1.90370 WP_000944149.1.90454 WP_000944149.1.90473 WP_000944149.1.90475 WP_000944149.1.90488 WP_000944149.1.90506 WP_000944149.1.90544 WP_000944149.1.9055 WP_000944149.1.90554 WP_000944149.1.90556 WP_000944149.1.90604 WP_000944149.1.90647 WP_000944149.1.90660 WP_000944149.1.90683 WP_000944149.1.9071 WP_000944149.1.90726 WP_000944149.1.90728 WP_000944149.1.90738 WP_000944149.1.90740 WP_000944149.1.90745 WP_000944149.1.90757 WP_000944149.1.90801 WP_000944149.1.90804 WP_000944149.1.90818 WP_000944149.1.90820 WP_000944149.1.90861 WP_000944149.1.90896 WP_000944149.1.90903 WP_000944149.1.90923 WP_000944149.1.9100 WP_000944149.1.91011 WP_000944149.1.91054 WP_000944149.1.91126 WP_000944149.1.9114 WP_000944149.1.91158 WP_000944149.1.91177 WP_000944149.1.912 WP_000944149.1.9122 WP_000944149.1.91233 WP_000944149.1.91246 WP_000944149.1.91258 WP_000944149.1.91279 WP_000944149.1.91297 WP_000944149.1.91300 WP_000944149.1.91332 WP_000944149.1.91346 WP_000944149.1.91357 WP_000944149.1.91364 WP_000944149.1.91371 WP_000944149.1.91382 WP_000944149.1.9140 WP_000944149.1.91420 WP_000944149.1.91427 WP_000944149.1.91487 WP_000944149.1.91500 WP_000944149.1.9153 WP_000944149.1.91559 WP_000944149.1.91573 WP_000944149.1.91581 WP_000944149.1.91587 WP_000944149.1.91611 WP_000944149.1.91624 WP_000944149.1.91639 WP_000944149.1.91660 WP_000944149.1.91745 WP_000944149.1.91746 WP_000944149.1.91749 WP_000944149.1.91771 WP_000944149.1.91791 WP_000944149.1.91800 WP_000944149.1.91816 WP_000944149.1.91829 WP_000944149.1.91895 WP_000944149.1.91909 WP_000944149.1.91919 WP_000944149.1.91928 WP_000944149.1.91950 WP_000944149.1.92 WP_000944149.1.92080 WP_000944149.1.92133 WP_000944149.1.92147 WP_000944149.1.92164 WP_000944149.1.92169 WP_000944149.1.92173 WP_000944149.1.92185 WP_000944149.1.92196 WP_000944149.1.92227 WP_000944149.1.9224 WP_000944149.1.92253 WP_000944149.1.92254 WP_000944149.1.923 WP_000944149.1.9234 WP_000944149.1.9237 WP_000944149.1.9239 WP_000944149.1.92415 WP_000944149.1.92425 WP_000944149.1.92436 WP_000944149.1.92442 WP_000944149.1.92497 WP_000944149.1.92500 WP_000944149.1.92520 WP_000944149.1.92534 WP_000944149.1.92546 WP_000944149.1.92565 WP_000944149.1.92607 WP_000944149.1.92667 WP_000944149.1.92679 WP_000944149.1.92688 WP_000944149.1.92691 WP_000944149.1.92723 WP_000944149.1.92735 WP_000944149.1.92741 WP_000944149.1.92765 WP_000944149.1.92773 WP_000944149.1.92789 WP_000944149.1.92805 WP_000944149.1.92862 WP_000944149.1.92864 WP_000944149.1.92918 WP_000944149.1.9293 WP_000944149.1.92937 WP_000944149.1.92950 WP_000944149.1.92960 WP_000944149.1.92965 WP_000944149.1.9305 WP_000944149.1.93074 WP_000944149.1.93125 WP_000944149.1.93163 WP_000944149.1.93176 WP_000944149.1.93191 WP_000944149.1.93198 WP_000944149.1.93224 WP_000944149.1.93260 WP_000944149.1.93263 WP_000944149.1.93296 WP_000944149.1.9330 WP_000944149.1.93300 WP_000944149.1.93336 WP_000944149.1.93374 WP_000944149.1.93416 WP_000944149.1.93438 WP_000944149.1.93444 WP_000944149.1.93514 WP_000944149.1.9352 WP_000944149.1.93538 WP_000944149.1.9354 WP_000944149.1.9358 WP_000944149.1.93590 WP_000944149.1.93647 WP_000944149.1.93658 WP_000944149.1.93669 WP_000944149.1.93678 WP_000944149.1.93710 WP_000944149.1.93722 WP_000944149.1.93736 WP_000944149.1.93738 WP_000944149.1.93758 WP_000944149.1.93769 WP_000944149.1.93787 WP_000944149.1.9387 WP_000944149.1.93882 WP_000944149.1.93883 WP_000944149.1.93891 WP_000944149.1.93975 WP_000944149.1.93976 WP_000944149.1.9398 WP_000944149.1.93981 WP_000944149.1.94074 WP_000944149.1.9408 WP_000944149.1.94082 WP_000944149.1.94087 WP_000944149.1.94093 WP_000944149.1.94096 WP_000944149.1.94119 WP_000944149.1.94122 WP_000944149.1.94130 WP_000944149.1.94165 WP_000944149.1.94182 WP_000944149.1.94229 WP_000944149.1.94268 WP_000944149.1.94293 WP_000944149.1.94294 WP_000944149.1.9430 WP_000944149.1.94335 WP_000944149.1.94340 WP_000944149.1.9437 WP_000944149.1.94374 WP_000944149.1.94375 WP_000944149.1.94376 WP_000944149.1.94389 WP_000944149.1.94407 WP_000944149.1.94414 WP_000944149.1.94530 WP_000944149.1.94550 WP_000944149.1.94576 WP_000944149.1.94625 WP_000944149.1.9464 WP_000944149.1.94688 WP_000944149.1.94719 WP_000944149.1.94733 WP_000944149.1.94741 WP_000944149.1.94789 WP_000944149.1.94797 WP_000944149.1.94838 WP_000944149.1.94844 WP_000944149.1.94845 WP_000944149.1.9485 WP_000944149.1.94857 WP_000944149.1.94866 WP_000944149.1.9497 WP_000944149.1.94980 WP_000944149.1.94989 WP_000944149.1.94999 WP_000944149.1.95002 WP_000944149.1.95038 WP_000944149.1.95075 WP_000944149.1.95077 WP_000944149.1.9510 WP_000944149.1.95120 WP_000944149.1.95210 WP_000944149.1.95318 WP_000944149.1.95327 WP_000944149.1.95342 WP_000944149.1.95361 WP_000944149.1.95372 WP_000944149.1.9538 WP_000944149.1.95442 WP_000944149.1.95512 WP_000944149.1.95535 WP_000944149.1.95537 WP_000944149.1.95550 WP_000944149.1.95552 WP_000944149.1.95581 WP_000944149.1.95603 WP_000944149.1.95631 WP_000944149.1.95639 WP_000944149.1.95640 WP_000944149.1.95681 WP_000944149.1.95699 WP_000944149.1.95704 WP_000944149.1.95713 WP_000944149.1.95714 WP_000944149.1.95737 WP_000944149.1.95760 WP_000944149.1.95804 WP_000944149.1.95806 WP_000944149.1.95832 WP_000944149.1.95877 WP_000944149.1.95885 WP_000944149.1.95914 WP_000944149.1.95918 WP_000944149.1.95986 WP_000944149.1.95997 WP_000944149.1.96014 WP_000944149.1.96030 WP_000944149.1.96056 WP_000944149.1.96057 WP_000944149.1.96067 WP_000944149.1.96075 WP_000944149.1.96105 WP_000944149.1.96135 WP_000944149.1.96148 WP_000944149.1.9617 WP_000944149.1.96209 WP_000944149.1.96228 WP_000944149.1.96255 WP_000944149.1.96283 WP_000944149.1.96297 WP_000944149.1.96312 WP_000944149.1.96314 WP_000944149.1.96322 WP_000944149.1.96334 WP_000944149.1.96362 WP_000944149.1.96364 WP_000944149.1.96424 WP_000944149.1.96433 WP_000944149.1.96468 WP_000944149.1.96472 WP_000944149.1.96477 WP_000944149.1.96489 WP_000944149.1.9650 WP_000944149.1.96535 WP_000944149.1.96538 WP_000944149.1.96554 WP_000944149.1.96566 WP_000944149.1.96578 WP_000944149.1.96591 WP_000944149.1.96603 WP_000944149.1.96637 WP_000944149.1.96638 WP_000944149.1.96678 WP_000944149.1.96699 WP_000944149.1.96705 WP_000944149.1.96718 WP_000944149.1.9675 WP_000944149.1.96780 WP_000944149.1.96836 WP_000944149.1.96855 WP_000944149.1.96859 WP_000944149.1.96922 WP_000944149.1.96956 WP_000944149.1.96965 WP_000944149.1.96969 WP_000944149.1.96976 WP_000944149.1.96985 WP_000944149.1.96997 WP_000944149.1.97000 WP_000944149.1.97007 WP_000944149.1.97014 WP_000944149.1.97017 WP_000944149.1.97029 WP_000944149.1.97033 WP_000944149.1.97034 WP_000944149.1.97138 WP_000944149.1.97141 WP_000944149.1.97146 WP_000944149.1.97161 WP_000944149.1.97164 WP_000944149.1.97205 WP_000944149.1.97228 WP_000944149.1.97241 WP_000944149.1.97302 WP_000944149.1.97312 WP_000944149.1.97336 WP_000944149.1.97348 WP_000944149.1.97352 WP_000944149.1.97355 WP_000944149.1.97367 WP_000944149.1.9737 WP_000944149.1.97392 WP_000944149.1.97409 WP_000944149.1.97411 WP_000944149.1.97427 WP_000944149.1.97444 WP_000944149.1.97450 WP_000944149.1.97456 WP_000944149.1.97460 WP_000944149.1.9748 WP_000944149.1.97494 WP_000944149.1.97530 WP_000944149.1.97531 WP_000944149.1.97537 WP_000944149.1.97575 WP_000944149.1.97576 WP_000944149.1.9758 WP_000944149.1.97585 WP_000944149.1.97641 WP_000944149.1.97664 WP_000944149.1.97687 WP_000944149.1.97696 WP_000944149.1.97699 WP_000944149.1.97729 WP_000944149.1.97742 WP_000944149.1.97744 WP_000944149.1.97746 WP_000944149.1.97758 WP_000944149.1.97762 WP_000944149.1.97786 WP_000944149.1.9788 WP_000944149.1.9789 WP_000944149.1.97899 WP_000944149.1.97935 WP_000944149.1.97953 WP_000944149.1.97955 WP_000944149.1.97974 WP_000944149.1.97997 WP_000944149.1.98054 WP_000944149.1.98058 WP_000944149.1.98073 WP_000944149.1.98161 WP_000944149.1.98174 WP_000944149.1.98179 WP_000944149.1.98195 WP_000944149.1.98233 WP_000944149.1.98248 WP_000944149.1.98249 WP_000944149.1.98281 WP_000944149.1.98295 WP_000944149.1.98328 WP_000944149.1.98352 WP_000944149.1.98353 WP_000944149.1.98360 WP_000944149.1.98366 WP_000944149.1.98379 WP_000944149.1.98387 WP_000944149.1.98409 WP_000944149.1.98411 WP_000944149.1.98425 WP_000944149.1.98497 WP_000944149.1.98548 WP_000944149.1.98559 WP_000944149.1.98585 WP_000944149.1.986 WP_000944149.1.98609 WP_000944149.1.98659 WP_000944149.1.98667 WP_000944149.1.98710 WP_000944149.1.9872 WP_000944149.1.98723 WP_000944149.1.98730 WP_000944149.1.98734 WP_000944149.1.98741 WP_000944149.1.98750 WP_000944149.1.98786 WP_000944149.1.98797 WP_000944149.1.98805 WP_000944149.1.98807 WP_000944149.1.98821 WP_000944149.1.98842 WP_000944149.1.98880 WP_000944149.1.98883 WP_000944149.1.98894 WP_000944149.1.98912 WP_000944149.1.98978 WP_000944149.1.98981 WP_000944149.1.98985 WP_000944149.1.99027 WP_000944149.1.9903 WP_000944149.1.99081 WP_000944149.1.991 WP_000944149.1.9910 WP_000944149.1.99136 WP_000944149.1.99171 WP_000944149.1.99174 WP_000944149.1.99207 WP_000944149.1.99217 WP_000944149.1.99228 WP_000944149.1.99237 WP_000944149.1.99249 WP_000944149.1.99283 WP_000944149.1.99308 WP_000944149.1.99311 WP_000944149.1.99331 WP_000944149.1.99359 WP_000944149.1.9936 WP_000944149.1.99414 WP_000944149.1.99418 WP_000944149.1.99430 WP_000944149.1.99494 WP_000944149.1.99509 WP_000944149.1.99523 WP_000944149.1.99536 WP_000944149.1.99569 WP_000944149.1.99638 WP_000944149.1.9965 WP_000944149.1.99686 WP_000944149.1.9974 WP_000944149.1.99849 WP_000944149.1.99859 WP_000944149.1.9987 WP_000944149.1.99884 WP_000944149.1.99954 WP_000944149.1.99955 WP_000944149.1.99984 WP_000944149.1.99999 YP_501463.1.76163 gi|88196632|ref|YP_501463.1| gi|470196184|ref|YP_007582536.1| gi|470223707|ref|YP_007622264.1| gi|387151804|ref|YP_005743368.1| gi|470219885|ref|YP_007620279.1| gi|57651071|ref|YP_187489.1| 158878.SAV2679 158879.SA2471 196620.MW2598 282459.SAS2564 359786.SaurJH9_2703 359787.SaurJH1_2760 418127.SAHV_2663 426430.NWMN_2577 681288.SAAV_2753 93061.SAOUHSC_03014 93062.SACOL2703 gi|384865852|ref|YP_005751211.1| gi|148269112|ref|YP_001248055.1| gi|15925669|ref|NP_373203.1| gi|404480006|ref|YP_006711436.1| gi|269204319|ref|YP_003283588.1| gi|470200118|ref|YP_007586518.1| gi|21284327|ref|NP_647415.1| gi|49487457|ref|YP_044678.1| gi|156980994|ref|YP_001443253.1| gi|151222789|ref|YP_001333611.1| gi|470194218|ref|YP_007580571.1| gi|470192253|ref|YP_007578563.1| gi|386730415|ref|YP_006196798.1| gi|470198149|ref|YP_007584550.1| gi|150395194|ref|YP_001317869.1| gi|15928265|ref|NP_375798.1| gi|470225674|ref|YP_007624253.1| gi|387603961|ref|YP_005735482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]