SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171463130|ref|YP_001797243.1| from Polynucleobacter necessarius subsp. necessarius STIR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171463130|ref|YP_001797243.1|
Domain Number 1 Region: 376-562
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.6e-43
Family Pyruvate oxidase and decarboxylase PP module 0.00046
Further Details:      
 
Domain Number 2 Region: 1-180
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.13e-42
Family Pyruvate oxidase and decarboxylase Pyr module 0.00016
Further Details:      
 
Domain Number 3 Region: 161-369
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 6.17e-35
Family Pyruvate oxidase and decarboxylase, middle domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171463130|ref|YP_001797243.1|
Sequence length 601
Comment thiamine pyrophosphate protein TPP binding domain-containing protein [Polynucleobacter necessarius subsp. necessarius STIR1]
Sequence
MKLSDYVAQKVVENGVKHVFMVTGGGAMHLNHSFGTRKDLECIFNHHEQACAIGAEAYYR
LTNRLPIVNVTSGPGGTNAITGVYGAFVDSVAMLVISGQVKWETTVRSTGLPLRQYGDQE
LDIEELVRPVTKYCEMVTDPQTIRYHLEKAIYLAQSGRPGPCWLDIPLNVQGAQIDPDAL
VGFDPAELEEPWKKTDLKRVSKDILDKVRAAKRPVVFVGGGIRLSGEHKSFLKLVEKLQI
PVVTGWNAHDVIWNSHPNYAGRPGTIGDRAGNFVTQNADLLLVLGSRLNIRQVSYNWQSF
AREAFKIWVDIDELELKKPSVKADMPIHANLKDLLPILAGARYEGATPEHKEWMEWSKER
MRRFPTVLPEYRENNRVNPYCFVDELFKQLKDDQIVVTGNGSACVVSFQAADLKPGQRLW
TNSGCATMGYDLPASIGAHKASGGKSIVCLAGDGSIMMNLQELQTIAGNQIPVKIFILNN
SGYVSIFQTHRNFFNGVEVGGGPKSGVTFPSFEKLSAAFDLPYLRVENHSQMQDAIEATL
QEVGPCVCEIMIDESVVFAPKLGAKQHPDGRITSPPLEDLSPFLSREVLRENMTIESPQE
E
Download sequence
Identical sequences B1XTF2
452638.Pnec_0337 WP_012357396.1.32496 gi|171463130|ref|YP_001797243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]