SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171463516|ref|YP_001797629.1| from Polynucleobacter necessarius subsp. necessarius STIR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171463516|ref|YP_001797629.1|
Domain Number 1 Region: 397-590
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.07e-67
Family Pyruvate oxidase and decarboxylase PP module 0.0000132
Further Details:      
 
Domain Number 2 Region: 26-208
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.2e-64
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000419
Further Details:      
 
Domain Number 3 Region: 212-386
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.1e-61
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000712
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171463516|ref|YP_001797629.1|
Sequence length 595
Comment acetolactate synthase large subunit [Polynucleobacter necessarius subsp. necessarius STIR1]
Sequence
MNTSSAEFLATKANKDSINTNNDAAPPEMIGAEMLVHALYKEGVEFVWGYPGGSVLFIYD
EIFKQDKFEHILVRHEQAAVHAADGYARATGKVGVALVTSGPGVTNAVTGIATAYTDSIP
VVIISGNVPTYAIGEDAFQEADTVGITRPVVKHNFLVKDVKDLPLVLKKAFHIAQTGRPG
PVLIDIPKDVSAAKGPFVYPETLEMRSYNPVVKGHGGQIRKAVALLQEAERPYIYTGGGV
ILSDAAPELKEFADLLGYPVTNALMGLGGFPGTSPQFLGMLGMHGTYEANMAMQHSDVLI
AIGARFDDRVIGNTAHFASHPRKIIHIDIDPSVISKRVKVDVPIVGNLKEVLVEMIAQLK
AAGPRKNGDKVAVWWDQINEWRKKDCLKYDEASQIVKPQYVVQKLWELTSGDAFICSDVG
QHQMWAAQFYRFDKPRRWINSGGLGTMGVGLPYAMGIKKAFPEKDIFTITGEGSIQMCIQ
ELSTCKQYDTPVKIVSLNNRYLGMVRQWQELTYNKRYSTSYMDSLPDFVKLAEAYGHVGM
RIEKKSDVEGALKEAIRLKDRTVFMDFQTDPEENVWPMVQAGKGITEMLLGSENL
Download sequence
Identical sequences B1XUI8
452638.Pnec_0810 WP_012357781.1.32496 gi|171463516|ref|YP_001797629.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]