SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171463763|ref|YP_001797876.1| from Polynucleobacter necessarius subsp. necessarius STIR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171463763|ref|YP_001797876.1|
Domain Number 1 Region: 65-471
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.13e-132
Family TK-like PP module 0.000000000151
Further Details:      
 
Domain Number 2 Region: 478-706
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.94e-95
Family TK-like Pyr module 0.0000000418
Further Details:      
 
Domain Number 3 Region: 707-897
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.26e-53
Family Transketolase C-terminal domain-like 0.00000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171463763|ref|YP_001797876.1|
Sequence length 898
Comment pyruvate dehydrogenase subunit E1 [Polynucleobacter necessarius subsp. necessarius STIR1]
Sequence
MAAVPDQVLGKQNVQDADPGETQEWLQALDGVIRNGGPERAAYLIDQQISHARVNGVVQP
FHVETSYINTIPVENQARLPGDQNVEHRIRSYTRWNAMAMVLRANKDTNVGGHISSFQSA
ATLYDVGFNHFWHAPSPEHGGDLIFVQGHSAPGVYARAYMLGRLEEGQLNNFRQEVGGKG
ISSYPHPWLMPDFWQFPTVSMGLGPIMAIYQARFMKYLTDRGFIQEQGRKVWAFLGDGET
DEPESLGAISMAGREKLDNLIFVINCNLQRLDGPVRGNGKIIQELEGEFRGAGWNVIKVV
WGGQWDALFARDKKGILMQRLGEIVDGQYQTMKSKNGAYVREIVFNTPELKALVSDWSDD
GIWQLNRGGHDPHKVFAAFHAAVNHKEQPTVILAHTIKGYGMGGSGEAMNIAHQAKKMNA
DDVRRFRDRFEIPVKDEQLDEMPLVKFAEGSPEFEYMKARRQELGGYLPQRRMKAESLPV
PALDAFAPLLEATTEGREISTTMAFVRMLNTVVRDKVLGRRVVPIVPDESRTFGMEGMFR
QLGIWNQLGQLYIPEDHDQLMFYKEDKTGQILQEGINEAGGMCDWIAAATSYSTHGVPML
PFYIFYSMFGFQRIGDLAWAAGDMRSRGFLLGGTAGRTTLNGEGLQHEDGHSHLWSGAVP
NCISYDPTFSFELAVVIQDGMRRMLEVQEDVYYYVTLMNENYAHPAMPKGAEQDIIKGMY
KLKSVGDANAKLRVQLLGSGTIFREVIEVAEILHKDWGIASDLWGCPSFTELGRDWTAVH
RSNLLNPAAAPALSHVEKCLKDTAGPVIAATDYVRLFAEQIRPAIQHMGRRYEVLGTDGF
GRSDTREKLRDFFEVDRRWVVLTALRSLVDSGQLDRSRLAEAIKKYDIDTTKPNPMTV
Download sequence
Identical sequences B1XV85
gi|171463763|ref|YP_001797876.1| WP_012358025.1.32496 452638.Pnec_1088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]