SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171464162|ref|YP_001798275.1| from Polynucleobacter necessarius subsp. necessarius STIR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171464162|ref|YP_001798275.1|
Domain Number 1 Region: 38-269
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.49e-54
Family Extended AAA-ATPase domain 0.00000031
Further Details:      
 
Domain Number 2 Region: 275-348
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-26
Family Helicase DNA-binding domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171464162|ref|YP_001798275.1|
Sequence length 356
Comment Holliday junction DNA helicase RuvB [Polynucleobacter necessarius subsp. necessarius STIR1]
Sequence
MAIHTDNLSSIPEDLPEGNDRIVSGSAGNAEAVFERALRPKQLNEYVGQTKARAQLEIFI
SATRARQEALDHVLLFGPPGLGKTTLAHIIARELGVNLRQTSGPVLDRPGDLAALLTNLE
ENDVLFIDEIHRLSPVVEEILYPALEDYSLDIMIGEGPAARSVKIDLKPFTLIGATTRAG
MLTNPLRDRFGIVARLEFYTTKELTKIINRSTSLLKADIDPDGSIEIAKRARGTPRIANR
LLRRVRDYAEVKGTGTITKAMADAALKMLDVDPSGFDVMDRKLLEAILHKFDGGPVGIDN
LAAAIGEERDTIEDVLEPYLIQQGYLQRTSRGRVATRQAYEHFGLTPPSGSASLDI
Download sequence
Identical sequences B1XS26
gi|171464162|ref|YP_001798275.1| WP_012358420.1.32496 452638.Pnec_1584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]