SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384421898|ref|YP_005631257.1| from Treponema pallidum subsp. pallidum str. Chicago

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384421898|ref|YP_005631257.1|
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.19e-44
Family PP-loop ATPase 0.00034
Further Details:      
 
Domain Number 2 Region: 361-435
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000262
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384421898|ref|YP_005631257.1|
Sequence length 447
Comment tRNA(Ile)-lysidine synthase [Treponema pallidum subsp. pallidum str. Chicago]
Sequence
MLVAVSGGADSLALLYAAHELAPDFGVCACAVTVDHSLRAQEGALDARFVRALCARFSPP
LPCFVQQISAGAVHACAKIRGRGVQDAARALRYKVFDHVAARCGAQVVLTAHTRDDQYET
LLMRLFQGAAASALQGIRAARGRYVRPLLKVSRTCVEDFLQTRGVRWREDASNTCRKYVR
NRIRHELIPALDAVLAGWRSGLDKTFAGISAEHSFCVAALTRWREGCSHAWEPVPRALGT
RLRMPRSDFLAAEFILRFFLLQEACVRLGVSHRVPRGALERCARFDGVRRIHVSGLQLER
AGAYVLFSCIHASDTARETKKQDAGSPPSSEKQGVSAIYVARPGAYPCACGTLLVEVRPA
GVFVCCAQDHVGVGPFSFPFYIRTHRTGDTISIRGGHKGIRKMFSEWHVPLSDRTVLPMI
EQDGVLRALYGAALGYQNRYAERTPHE
Download sequence
Identical sequences gi|384421898|ref|YP_005631257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]