SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|172057081|ref|YP_001813541.1| from Exiguobacterium sibiricum 255-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172057081|ref|YP_001813541.1|
Domain Number 1 Region: 250-548
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.44e-88
Family DNA repair protein MutS, domain III 0.000000805
Further Details:      
 
Domain Number 2 Region: 550-782
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-62
Family ABC transporter ATPase domain-like 0.000000596
Further Details:      
 
Domain Number 3 Region: 4-115
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.44e-41
Family DNA repair protein MutS, domain I 0.0000275
Further Details:      
 
Domain Number 4 Region: 119-260
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 5.62e-28
Family DNA repair protein MutS, domain II 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|172057081|ref|YP_001813541.1|
Sequence length 843
Comment DNA mismatch repair protein MutS [Exiguobacterium sibiricum 255-15]
Sequence
MEAVHNTPMMKQYFSIKADYPDAFLFYRLGDFYELFFEDAKQVAHELELTLTAKNGKNAE
HPIPMCGVPHHAANGYIEQLIERGYKVALCDQVEDPKLTKGLVKREVVQVITPGTLMSSL
TEKENRYLVAVVEQDGRFGIARGDVSTGESALTSVATLDAVAKELSIILPREIVVTSSEH
EAALSHLQIPLTQSTRRETHPHGDRAIDAAQADAFAVLYAYMHDTQKRSLAHLQPAIVYE
AADFMQLEPNTVKNLELVRSARTGDKKGSLLGLLDVTGTAMGGRMLKRWLEKPLLSQHTI
AERLDAVEELLAHYFERQQLKDTLREVYDLERLVAKVGYGTASARDLVQLKSTLRLIPRI
QAALEELFSDRLGQLALGLDPHDELTDLLDRAFVEAPPISTKDGGMIRTGFDPALDELLV
ASKDGKTWLATLEASERQATGIKTLKIGYNRVFGYYIEVSRANAKLLPEGRYERKQTLAN
AERYVTPELKEKEALILGAEEKSITLEYELFCQVRDQVKTHIESLQRVSRRIAELDVLVA
LAETAERHDYVRPVTLTGRNVMIENGRHPVIETVLPRGEYVANGINLNEDREMLLITGPN
MSGKSTYMRQFALIALLHQIGSFVPASRAELPIFDQIFTRIGAADDLVSGQSTFMVEMVE
TQEALTRATDRSLILLDEIGRGTSTYDGMALAQAIVEHIAEHVGAKTLFSTHYHELTVLE
DSMPRLANVHVRAVEQDGRVVFLHEVRDGKADQSYGIHVARLADLPDALIARAEVLLSEF
EQTEERTVVSPKEPVVQAEPVDQLSLFAETDPVRETVQTLDLINMTPLEALNTLYRLQAE
ARK
Download sequence
Identical sequences B1YMD7
gi|172057081|ref|YP_001813541.1| WP_012369947.1.68707 262543.Exig_1044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]