SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|172058145|ref|YP_001814605.1| from Exiguobacterium sibiricum 255-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172058145|ref|YP_001814605.1|
Domain Number 1 Region: 4-224
Classification Level Classification E-value
Superfamily HemD-like 1.06e-41
Family HemD-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|172058145|ref|YP_001814605.1|
Sequence length 228
Comment uroporphyrinogen III synthase HEM4 [Exiguobacterium sibiricum 255-15]
Sequence
MTCKRLVLTGSRRPTAEQVERLTAQRIEVVHHPVIETIPVDFQLPAELDWLIVTSPTGVE
RIQSELPFLQHTKIAVVGSKTAAALIKQGRTPDFIPSAFTGDVLVEELRPLLRTGQRICF
ARGNRSRQEPLERLKNAVAAEVLEVITYETKLRVIPPDLLQQTAYIGLQSPSAVEAIAPL
CQETTATYVTIGPITEQAARRFGLTPLLVAAVYTLDGLIDCILEEELL
Download sequence
Identical sequences B1YJV0
262543.Exig_2136 WP_012371005.1.68707 gi|172058145|ref|YP_001814605.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]