SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|172058192|ref|YP_001814652.1| from Exiguobacterium sibiricum 255-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172058192|ref|YP_001814652.1|
Domain Number 1 Region: 214-397
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.66e-73
Family B3/B4 domain of PheRS, PheT 0.0000056
Further Details:      
 
Domain Number 2 Region: 470-689
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.45e-45
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000849
Further Details:      
 
Domain Number 3 Region: 36-198
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.03e-43
Family Myf domain 0.0047
Further Details:      
 
Domain Number 4 Region: 700-797
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.57e-31
Family Anticodon-binding domain of PheRS 0.00026
Further Details:      
 
Domain Number 5 Region: 408-477
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.65e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|172058192|ref|YP_001814652.1|
Sequence length 798
Comment phenylalanyl-tRNA synthetase subunit beta [Exiguobacterium sibiricum 255-15]
Sequence
MLVSKQWLQEFVDVRHKTGQELADLITKSGIEVEGVEVRDADLNNIVVGRVLTKEKHPEA
DKLNVTTVDIGQEEPVQIVCGAPNVDAGQDVIVARVGARLPGIKIKRAKLRGVVSEGMIC
SLEELGFEKKYIREDEQDGIHTFREPVTPGQDVLELLGLHDEVLELGLTPNRSDCLSMYG
VAHEVAGILNTTPVFPSVEVPEAASSTAVTVQLDSEACTFYAAREIRDITIGESPLWLKN
RLIANGIRPINNVVDITNFVLLETGQPLHAFDANKLGQQIVVRQAKAGETFQTLDEVERT
LDPSMLVITDGERPVALAGVMGGANTEVDSATTSIVLESAYFAPTSVRKTSRVLGLRSDS
SSRFEKGVDPRRVVLALDRAAMLIAELAGGTVLSGTAEAGTLQLEDHLIEGSVSYINHRL
GMEIEGTVMKDLLERLGLEVELSADALTVSVPTRRQDLMIPADLAEEVARLYGYDALTSS
LPREASRGFLPKRNQHRRKMRQLLQGAGLSQAITYSLTSEQRAMQFNEQQDLHPVKLAMP
ISEARSTLRTSLIPGLLEVAQHNVARQHADLAYYELGSVYLQRDASLETLPLEQEMLAGI
MVGLAEQHRVHGTHVKTDFFVIKGIVETLAEALDVPLTYEAAAMQSMHPGRTARILLDGE
AIGFVGQVHPGLSKEEYGLKEVYVFELDAMALHSKVARVYQEISRFPSMTRDVAIVLDRS
VSASEVEAVIMQAAGPLLKQVELFDVYTGDNVGADQKSFAFSLRYQNKERTLVDEEVTTA
HQQVIEALQSSFKAELRS
Download sequence
Identical sequences B1YJZ7
262543.Exig_2183 gi|172058192|ref|YP_001814652.1| WP_012371052.1.68707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]