SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|172058195|ref|YP_001814655.1| from Exiguobacterium sibiricum 255-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172058195|ref|YP_001814655.1|
Domain Number 1 Region: 4-81,173-355
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.5e-69
Family Bacterial dinuclear zinc exopeptidases 0.000000359
Further Details:      
 
Domain Number 2 Region: 71-181
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.98e-35
Family Aminopeptidase/glucanase lid domain 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|172058195|ref|YP_001814655.1|
Sequence length 360
Comment cellulase [Exiguobacterium sibiricum 255-15]
Sequence
MNEQLHMLKRLTDATGVPGNEKEVRQLMREYLEPHAENFHQDGLGSLFAERQGAGEDAPR
ILIAGHMDEVGFMVTKIDEKGFLRFQPLGGWWGQVLLAQRMNIVTSSGEVIPGVIGAKPP
HVLPPEARNKPVDIKEMFIDIGATSKEEVEGWGIRPGDTVVPHCEFTVMKNDNFLMAKAW
DNRVGCAIAIEAIKRLKEEGHPNTIFAGATVQEEVGLRGAQTIANLLRPTIAFAVDTGIP
GDTPGMTDREALSKLGEGVQVILFDATMIAHRGLIDFVTTVAKEENIKYQLDLTPGGGTD
AAKFHLSHTGVPSLALTVPIRYLHTNVSIMHKADFEAAVDLIVAVTKRLDAETVQAIYEG
Download sequence
Identical sequences B1YK00 T2AAQ7
gi|172058195|ref|YP_001814655.1| WP_012371055.1.32559 WP_012371055.1.68707 262543.Exig_2186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]