SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170741626|ref|YP_001770281.1| from Methylobacterium sp. 4-46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170741626|ref|YP_001770281.1|
Domain Number 1 Region: 8-157
Classification Level Classification E-value
Superfamily YjgF-like 7.07e-53
Family YjgF/L-PSP 0.0000769
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170741626|ref|YP_001770281.1|
Sequence length 159
Comment endoribonuclease L-PSP [Methylobacterium sp. 4-46]
Sequence
MPTQEEPTPEDALAALGLSLPEVPVPVANYVPYRLVGECLYLSGQGPKRPDGTYRTGRLG
RDTTIEEGYADARLAGLQLLAVAKAALGDLSRVTAVVKLLGMVNAEPDFADHPKVINGCS
DLFVAVLGEAGRHARSAVGMGSLPNGMTVEVEAILQVSR
Download sequence
Identical sequences B0U9J5
426117.M446_3462 WP_012333246.1.41957 gi|170741626|ref|YP_001770281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]