SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170743029|ref|YP_001771684.1| from Methylobacterium sp. 4-46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170743029|ref|YP_001771684.1|
Domain Number 1 Region: 5-113
Classification Level Classification E-value
Superfamily YjgF-like 8.95e-32
Family YjgF/L-PSP 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170743029|ref|YP_001771684.1|
Sequence length 115
Comment endoribonuclease L-PSP [Methylobacterium sp. 4-46]
Sequence
MTIQRIETGARMSQAVVHNGTVYLAGQVAEGDDVAAQTRAILAQIEALLAQAGSAKERIL
SATIYLADIGAFADMNRVWDAWVPAGQAPARATVEAKLAGPQYRVEIAVIAAAGA
Download sequence
Identical sequences B0UEY0
WP_012334637.1.13143 WP_012334637.1.41957 426117.M446_4921 gi|170743029|ref|YP_001771684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]