SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169830335|ref|YP_001716317.1| from Candidatus Desulforudis audaxviator MP104C

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169830335|ref|YP_001716317.1|
Domain Number 1 Region: 6-299
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 6.08e-72
Family Methylenetetrahydrofolate reductase 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169830335|ref|YP_001716317.1|
Sequence length 306
Comment methylenetetrahydrofolate reductase [Candidatus Desulforudis audaxviator MP104C]
Sequence
MTTPSNLQRVLEQGHFAVTAEIGPPKGASGETVRRHAALLRDCTDAQNVTDNQSAVVHMC
SLAAAVHVLQAGGEPVFQLTTRDRNRLALQSDLLGAASLGIRNVLCLTGDHQKFGNHPQA
RGVFDLDSVQLVGLARRLCEGRFLNGDEVKPPPELFVGAVENPFAGPLPLRVLRLGKKIA
AGARFIQTQAVYDIELFARFMAAVREQGWDKEVSILAGVVPPKSAGALRYISKVPGMVVP
DKLIRRMKGAADQAREGKRFAVELIRHLRTIKGVRGVHIMAIRWEEAVPEIVTEAGLLPR
PHADKY
Download sequence
Identical sequences B1I1G0
WP_012301279.1.36146 gi|169830335|ref|YP_001716317.1| 477974.Daud_0117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]