SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169831043|ref|YP_001717025.1| from Candidatus Desulforudis audaxviator MP104C

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169831043|ref|YP_001717025.1|
Domain Number 1 Region: 7-302
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.28e-75
Family Methylenetetrahydrofolate reductase 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169831043|ref|YP_001717025.1|
Sequence length 314
Comment methylenetetrahydrofolate reductase [Candidatus Desulforudis audaxviator MP104C]
Sequence
MRGVSGLARLLGAGHFVVTCEVGPPKGVNVDGLTEKAALLKSFVDAANVTDCQTAVVRLS
SIAACVHLAAMGLEPVVQMTARDRNRIAVQSDLLGAYSLGIRNVLCLTGDHQKFGNHPGA
KGVFDLDSVQMVEMVRRLGAPGEFQCGEPVCGEPPVFFVGAVENPCAEPLELRVRRLEKK
IRAGARFVQTQCVYDLDRFRHFMGLVRARGLHEHAHILAGVTPLKSVRMARFMRDAVAGV
YVPDEVVARIEAAADPAAEGVAMCVEQIAALREIEGVAGVHIMAVAWEAIVPEIVRRAGL
YPRPADDEPKDRNR
Download sequence
Identical sequences B1I327
WP_012301979.1.36146 477974.Daud_0880 gi|169831043|ref|YP_001717025.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]