SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169831535|ref|YP_001717517.1| from Candidatus Desulforudis audaxviator MP104C

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169831535|ref|YP_001717517.1|
Domain Number 1 Region: 7-81
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 0.0000000000000327
Family Cell division protein ZapA-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169831535|ref|YP_001717517.1|
Sequence length 89
Comment hypothetical protein Daud_1376 [Candidatus Desulforudis audaxviator MP104C]
Sequence
MAGQTNRVEVEIFGERYVLRGDRPPDYIRFIAQDVDRRVRDICNRHSRIPVTTAAVLAAV
NLADELKRLQESYDGLVKMIEGEDKEKKK
Download sequence
Identical sequences B1I4I3
477974.Daud_1376 WP_012302470.1.36146 gi|169831535|ref|YP_001717517.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]