SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169831536|ref|YP_001717518.1| from Candidatus Desulforudis audaxviator MP104C

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169831536|ref|YP_001717518.1|
Domain Number 1 Region: 203-396
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.4e-67
Family B3/B4 domain of PheRS, PheT 0.00000223
Further Details:      
 
Domain Number 2 Region: 467-693
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.21e-49
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000831
Further Details:      
 
Domain Number 3 Region: 36-189
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.83e-44
Family Myf domain 0.0031
Further Details:      
 
Domain Number 4 Region: 700-799
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.48e-29
Family Anticodon-binding domain of PheRS 0.0004
Further Details:      
 
Domain Number 5 Region: 403-475
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 7.42e-18
Family Domains B1 and B5 of PheRS-beta, PheT 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|169831536|ref|YP_001717518.1|
Sequence length 800
Comment phenylalanyl-tRNA synthetase subunit beta [Candidatus Desulforudis audaxviator MP104C]
Sequence
MRVSINWLKEFVDIPVTSAELADRLTLAGVAVDRIDKPSAGVTGVVTGRVVEVRPHPNAD
RLLIAAVDIGGEILQIVTGAANFKVGDVVPVAPVGATLAGDLAIRRAKFRGVESWGMMCA
ADELGIGDDHEGILILPSDTPVGVAAGPILGLDDEILELDLTPNRGDCLSVLGVAREVAT
LLGKPLKRRKPAFPELDLQAQRMVRVDIEDPRLCSRYVARVLVDVRVGPSPLWMQTRLFT
AGVRPISNIVDVTNYVMLELGQPQHAFDYDAVHNAHVIVRRARPGETLVTLDGNERSLAP
DMLLITDPRTVIGVAGVMGGLDSEVTADTRRVLLESACFNPVSIRRTSRALGLRSEASIR
FEKGVDPEGCLKAADRALELMQIIGAGHAAAGAVDVYPDPYTPRTLIVRPERVEEILGLA
VPAKTIRDILERLEFAPRETGGRFLVRVPSHRTDVFREIDLIEEVARIHGYHRIPDTLPF
GVTVPGVRTKAQVLESRLRELLVACGLTEVITYTFTNRKVFDRLRLPGTSPLRRTVPLRN
PLNEDQTEMRTLLYPSLLDVLARNYQRRNTNAALFEIGRVYHPRDNAPLPEEGLRLAAAL
MGRTPAGWRRKDEPLDFFFLKGVLESVAREIGLETLTFTAEQDEPSFHPGRTARLRAGEA
NLGIIGELHPEVLEAYDLPPGVVVTEIDLDLVLAVDKKTPTFVPLPRFPSVERDLALVIR
KDIPAREVMALIRKAGGELLRELRLFDVYEGRQIREGYRNLGFSLVFRAEDRTLTDEEVG
RYLEAIIRTLEDTYGAQLRA
Download sequence
Identical sequences B1I4I4
gi|169831536|ref|YP_001717518.1| 477974.Daud_1377 WP_012302471.1.36146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]