SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169832349|ref|YP_001718331.1| from Candidatus Desulforudis audaxviator MP104C

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169832349|ref|YP_001718331.1|
Domain Number 1 Region: 58-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 2.49e-24
Family Ribosomal protein L9 C-domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 1.36e-16
Family Ribosomal protein L9 N-domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169832349|ref|YP_001718331.1|
Sequence length 150
Comment 50S ribosomal protein L9 [Candidatus Desulforudis audaxviator MP104C]
Sequence
MKVVLLKDVAGLGIRGQVVKVAEGYGRNYLIPKGLAEEATPGRIKELARLDQAREERVER
LAAQARKVAAGLKGLTVRIPARAGEGGKLFGSVGNKDIAAALAARHNLKIDRKKLELKEP
IRSLGKFPVLARLHPGVQVEFEVEVVDNGT
Download sequence
Identical sequences B1I6Q1
477974.Daud_2212 WP_012303273.1.36146 gi|169832349|ref|YP_001718331.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]