SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170289688|ref|YP_001736504.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170289688|ref|YP_001736504.1|
Domain Number 1 Region: 3-159
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, N-terminal domain 1.57e-51
Family Bacterial fluorinating enzyme, N-terminal domain 0.00055
Further Details:      
 
Domain Number 2 Region: 164-253
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, C-terminal domain 0.000000000000105
Family Bacterial fluorinating enzyme, C-terminal domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170289688|ref|YP_001736504.1|
Sequence length 257
Comment hypothetical protein Kcr_0061 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MVTLYLLTDFGYQDYYVGALKGVIKSICQRAEIIDLTHEVRKFDVRHGAFLLWQSLKWLE
KNSIIVGVVDPGVGTSRDPVMIRSGQFTFVGPDNGLFWPAVQSIGSYEAYKIDLRSTGLA
ERRTGTFDGRDVFAPIAAMLACGKSMDELGFEKKSLEILDLWRIRAEGRRIVGEVRNVDR
FGNIVTNIPWSYVRFEEAIVRVGDSYGRARVSPNYEYRGLLLIRGSSDLLEVSIAKGSAA
ELLNADLNYEISLEVIE
Download sequence
Identical sequences B1L7J4
gi|170289688|ref|YP_001736504.1| WP_012308718.1.97847 374847.Kcr_0061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]