SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170289733|ref|YP_001736549.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170289733|ref|YP_001736549.1|
Domain Number 1 Region: 180-274
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000017
Family Multidrug resistance efflux transporter EmrE 0.0082
Further Details:      
 
Domain Number 2 Region: 49-135
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000706
Family Multidrug resistance efflux transporter EmrE 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170289733|ref|YP_001736549.1|
Sequence length 275
Comment hypothetical protein Kcr_0106 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MSSKSGVIPLLLAAFLWSTIGLATKRALNAGSDAFWIGGMRAGVSAVLSLIFLRRRVLDF
KLALIGIFFTGPLYLIYVFSVMHSGMGIAAVLLYTAPVIVIILAKFLLNESLNTRKLIAL
ILSFSGIVAVGLRGGGNLDLVAIALGLGSSLSYSGIILGVRKLAVSGYDEIELGLGPQVW
AALELLPLLSLSRGSLNLDSMISIVYLGIFPSFLAYYLHAMGLKRIEAGPASIISNLEPI
SALILGIFLGEQPGLLGFLGSALIISSAIIVSWRR
Download sequence
Identical sequences B1L7N9
374847.Kcr_0106 gi|170289733|ref|YP_001736549.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]