SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170289813|ref|YP_001736629.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170289813|ref|YP_001736629.1|
Domain Number 1 Region: 158-221
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000264
Family MarR-like transcriptional regulators 0.051
Further Details:      
 
Domain Number 2 Region: 41-138
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0000628
Family MJ1460-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170289813|ref|YP_001736629.1|
Sequence length 222
Comment ArsR family transcriptional regulator [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MSTVMPRAQLVRNALTDILGATPAEVLGKTCSIFMRVVESSQEGDIMLYLFGLRLGEKLG
KELGEVAQEDSWSTLSEIFTFLGLAGGIEILTERPRSVLICVNPPGDPEKRVSCSLARGI
VLGFTSMISGDQLYVKERGPCPGERGCLLELTRTSEDVLMNPIRRAIVEYLRVNQGAHMR
QISRDLGISLGSLRWHLDVLERKGIVREKRKGNMTEFYLSDI
Download sequence
Identical sequences B1L3B7
gi|170289813|ref|YP_001736629.1| 374847.Kcr_0186 WP_012308843.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]