SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170289824|ref|YP_001736640.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170289824|ref|YP_001736640.1|
Domain Number 1 Region: 5-291
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1e-46
Family ROO N-terminal domain-like 0.00013
Further Details:      
 
Domain Number 2 Region: 245-385
Classification Level Classification E-value
Superfamily Flavoproteins 1.68e-28
Family Flavodoxin-related 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170289824|ref|YP_001736640.1|
Sequence length 393
Comment beta-lactamase domain-containing protein [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MTFIVREIAEGVILFRILNRVTEKFENFWPIPRGTSYNFYIVRGKDRTALIDGADIRFSD
EFFRALEERIKVEEIDYVITQHAEPDHSGTLAEVMRRASGAELLGTKQALAIGASLSNYP
LERAREIKDNERLELGGKTLRFVVAPMIHWPDTMMTFLEEDRILFTCDLFGSHGASEKVY
FDEDYFELADYYASILMPFPAMVANALQKVRALEPRILAPSHGALHRHVDSILRTYEDWA
SWKPKGRALIVIGSQYGNSEILAREAADGFREEGIEATLVDSSYAHPDDLLALTLESSAI
LIVSATHNGRPFLGVRYYLDLLEEYKPKNRVFGVIGTFGWGGGAGKYIKDFLESLKIPVV
AYMEAKGKPGERELREARELGKLLAIEAKKLLK
Download sequence
Identical sequences B1L3C8
WP_012308854.1.97847 gi|170289824|ref|YP_001736640.1| 374847.Kcr_0197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]