SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170290108|ref|YP_001736924.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290108|ref|YP_001736924.1|
Domain Number 1 Region: 187-283
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 3.27e-16
Family Multidrug resistance efflux transporter EmrE 0.0032
Further Details:      
 
Domain Number 2 Region: 45-140
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000000432
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170290108|ref|YP_001736924.1|
Sequence length 285
Comment DMT family permease [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MNRMGAGEWGLLIILSVLWGASFLFMGILVKELPPLTISASRLTIASLLIGILASRRPKN
LPWRELLILGVLNNTIPYALILWGQRYVSSSVASIINSTSPFFTSIFAHFLTDDEKINKF
SMMGISLGFSGVLAMAWDSAQGSLIGELAIITAVICYSYATVYGRRFYSMGLSPLDIAFG
QLSTAAATSIPLAILERPWLAMPSQRAWVSIIGISVFSTALAYLIFFRILERAGATNANL
VTLLIPVTATLLCTAFLGERLELRHIVGMCLIMTGLLIMNLRGEL
Download sequence
Identical sequences B1L462
gi|170290108|ref|YP_001736924.1| 374847.Kcr_0488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]